2W0P: Filamin A repeat 21

Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide. Determined by X-ray diffraction at 1.9 Å resolution. Released 30 Sept 2008.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 1,532
Mol. weight: 21.22 kDa
Released: 30 Sept 2008

Explore 2W0P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W0P contains 12 α-helices and 19 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	1
α-helix	2246-2248	3
β-strand	2251-2252	2	2
β-strand	2257-2262	6	1
α-helix	2264-2266	3
β-strand	2271-2277	7	2
α-helix	2280-2281	2
β-strand	2282-2287	6	1
β-strand	2293-2298	6	1
β-strand	2303-2311	9	2
β-strand	2314-2315	2	2
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	2

Chain B: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	3
α-helix	2246-2248	3
β-strand	2251-2252	2	2
β-strand	2257-2262	6	3
β-strand	2271-2277	7	2
α-helix	2280-2281	2
β-strand	2282-2287	6	3
β-strand	2293-2298	6	3
β-strand	2303-2311	9	2
β-strand	2314-2315	2	2
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	2
α-helix	2327-2328	2

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	9-15	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-a	A, B	protein	94	HOMO SAPIENS	P21333 (AlphaFold model)
Filamin-binding lim protein 1	C	protein	15	HOMO SAPIENS	Q8WUP2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2W0P_1 FILAMIN-A (chains A, B)
GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGV
AYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS

Sequence of entity 2 (C), FASTA

>2W0P_2 FILAMIN-BINDING LIM PROTEIN 1 (chains C)
PEKRVASSVFITLAP

Primary citation

Structural Basis of the Migfilin-Filamin Interaction and Competition with Integrin {Beta} Tails. Lad, Y., Jiang, P., Ruskamo, S. et al. J Biol Chem (2008) 283:35154. DOI 10.1074/JBC.M802592200 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex
3RGH 2.44 Å, Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

Browse structure collections

About this viewer

MolViewer shows 2W0P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.