9LWX: Filamin A repeat 21

Crystal structure of the Filamin A repeat 21. Determined by X-ray diffraction at 2.29 Å resolution. Released 5 Mar 2025.

Method: X-ray diffraction
Resolution: 2.29 Å
Organism: Esselenichthys carli
Chains: 4
Atoms: 2,848
Mol. weight: 40.21 kDa
Released: 5 Mar 2025

Explore 9LWX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LWX contains 15 α-helices and 37 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	3
α-helix	2246-2248	3
β-strand	2251-2252	2	4
β-strand	2257-2262	6	3
α-helix	2264-2266	3
β-strand	2271-2276	6	4
β-strand	2281-2287	7	3
β-strand	2292-2299	8	3
β-strand	2303-2311	9	4
β-strand	2314-2315	2	4
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	4

Chain B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	2
α-helix	2246-2248	3
β-strand	2251-2252	2	1
β-strand	2257-2262	6	2
β-strand	2271-2276	6	1
β-strand	2282-2287	6	2
β-strand	2292-2298	7	2
β-strand	2303-2311	9	1
β-strand	2314-2315	2	1
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	1

Chain C: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	5
α-helix	2246-2248	3
β-strand	2251-2252	2	6
β-strand	2255	1	6
β-strand	2257-2262	6	5
β-strand	2271-2276	6	6
β-strand	2282-2287	6	5
β-strand	2292-2298	7	5
β-strand	2303-2311	9	6
β-strand	2314-2315	2	6
α-helix	2316	1
β-strand	2321-2326	6	6

Chain D: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	1
α-helix	2246-2248	3
β-strand	2251-2252	2	2
β-strand	2257-2262	6	1
β-strand	2271-2276	6	2
β-strand	2281-2287	7	1
β-strand	2292-2299	8	1
β-strand	2303-2311	9	2
β-strand	2314-2315	2	2
α-helix	2316	1
β-strand	2321-2326	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-A	A, B, C, D	protein	98	Esselenichthys carli	P21333 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9LWX_1 Filamin-A (chains A, B, C, D)
AMGSGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDG
SCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS

Primary citation

Structural Basis of the LARP4-Filamin A Interaction and Competition with Integrin beta 7 Tails. Mao, Z., Ding, Y., Liu, Y. et al. J Mol Biol (2025) 437:169262-169262. DOI 10.1016/j.jmb.2025.169262 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex
3RGH 2.44 Å, Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

Browse structure collections

About this viewer

MolViewer shows 9LWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.