6EW1: Filamin A Ig-like domains 3-5 mutant P637Q

Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q. Determined by X-ray diffraction at 2.31 Å resolution. Released 31 Oct 2018.

Method: X-ray diffraction
Resolution: 2.31 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,218
Mol. weight: 31.05 kDa
Released: 31 Oct 2018

Explore 6EW1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EW1 contains 11 α-helices and 30 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	480-482	3
β-strand	484-486	3	1
α-helix	488-490	3
β-strand	496	1	2
β-strand	501-506	6	1
β-strand	515-521	7	3
β-strand	524-525	2	3
β-strand	528-532	5	1
β-strand	537-542	6	1
β-strand	548-556	9	3
β-strand	559-560	2	3
α-helix	564	1
β-strand	566-570	5	3
β-strand	571	1	2
α-helix	572-574	3
β-strand	579-582	4	4
α-helix	584-586	3
β-strand	588-590	3	5
β-strand	594-601	8	4
β-strand	609-614	6	5
β-strand	620-624	5	4
β-strand	630-636	7	4
β-strand	641-649	9	5
β-strand	653	1	5
α-helix	654	1
α-helix	657	1
β-strand	659-664	6	5
α-helix	665-667	3
β-strand	676	1	6
α-helix	680-682	3
β-strand	693-696	4	7
β-strand	698	1	6
β-strand	707-712	6	8
β-strand	718-719	2	8
β-strand	721-725	5	7
β-strand	731-735	5	7
α-helix	742	1
β-strand	743-749	7	8
β-strand	752-753	2	8
α-helix	754	1
β-strand	759-761	3	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-A	A	protein	291	Homo sapiens	P21333 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6EW1_1 Filamin-A (chains A)
SMCNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGD
GVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSA
DFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWQQEAGEYAVHVLCNSEDIR
LSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNE
GCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAG

Primary citation

Non-syndromic Mitral Valve Dysplasia Mutation Changes the Force Resilience and Interaction of Human Filamin A. Haataja, T.J.K., Bernardi, R.C., Lecointe, S. et al. Structure (2019) 27:102-112.e4. DOI 10.1016/j.str.2018.09.007 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex
3RGH 2.44 Å, Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

Browse structure collections

About this viewer

MolViewer shows 6EW1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.