3CNK: Dimerization domain of human filamin A

Crystal Structure of the dimerization domain of human filamin A. Determined by X-ray diffraction at 1.65 Å resolution. Released 10 Feb 2009.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,558
Mol. weight: 19.58 kDa
Released: 10 Feb 2009

Explore 3CNK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CNK contains 8 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2561-2563	3	1
α-helix	2565-2567	3
β-strand	2569	1	2
β-strand	2571	1	3
β-strand	2574	1	3
β-strand	2576-2581	6	1
β-strand	2590-2595	6	2
α-helix	2600-2601	2
β-strand	2603-2610	8	1
β-strand	2613-2619	7	1
β-strand	2624-2632	9	2
β-strand	2635-2636	2	2
α-helix	2637	1
α-helix	2640	1
β-strand	2642-2646	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-A	A, B	protein	89	Homo sapiens	P21333 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3CNK_1 Filamin-A (chains A, B)
KVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSY
LLKDKGEYTLVVKWGHEHIPGSPYRVVVP

Primary citation

Crystal structure of the dimerization domain of human filamin A. Seo, M.-D., Seok, S.-H., Im, H. et al. Proteins (2008) 75:258-263. DOI 10.1002/prot.22336 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex
3RGH 2.44 Å, Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

Browse structure collections

About this viewer

MolViewer shows 3CNK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.