2MC3: MUS81 endonuclease homolog, isoform CRA_b

NMR solution structure of the winged-helix domain from MUS81 structure-specific endonuclease. Determined by solution NMR. Released 18 Sept 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 811
Mol. weight: 12.01 kDa
Released: 18 Sept 2013

Explore 2MC3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MC3 contains 5 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	10-22	13
α-helix	25-27	3
β-strand	31	1	1
α-helix	33-43	11
α-helix	57-64	8
β-strand	67-68	2	2
β-strand	76	1	1
β-strand	77-78	2	2
α-helix	80-92	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MUS81 endonuclease homolog (Yeast), isoform CRA_b	A	protein	109	Homo sapiens	Q96NY9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MC3_1 MUS81 endonuclease homolog (Yeast), isoform CRA_b (chains A)
GPTMGSGSYWPARHSGARVILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSAPP
WPALRSLLHRNLVLRTHQPARYSLTPEGLELAQKLAESEGLSLLNVGIG

Primary citation

A winged helix domain in human MUS81 binds DNA and modulates the endonuclease activity of MUS81 complexes. Fadden, A.J., Schalbetter, S., Bowles, M. et al. Nucleic Acids Res (2013) 41:9741-9752. DOI 10.1093/nar/gkt760 · PubMed

Other PDB entries of the same protein (UniProt Q96NY9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BU5 1.8 Å, Crystal Structure of Human SLX4 and MUS81
9F9L 2.02 Å, Crystal structure of MUS81-EME1 bound by compound 16.
9F98 2.15 Å, Crystal structure of MUS81-EME1, apo form.
9F9M 2.47 Å, Crystal structure of MUS81-EME1 bound by compound 21.
9F9K 2.73 Å, Crystal structure of MUS81-EME1 bound by compound 15.
4P0P 2.8 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA, and Mg2+
9F99 2.8 Å, Crystal structure of MUS81-EME1 bound by compound 10.
4P0Q 2.85 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA
9F9A 2.91 Å, Crystal structure of MUS81-EME1 bound by compound 12.
7F6L 3.2 Å, Crystal structure of human MUS81-EME2 complex
2ZIX 3.5 Å, Crystal structure of the Mus81-Eme1 complex
4P0S 6.0 Å, human Mus81-Eme1-3'flap DNA complex

Browse structure collections

About this viewer

MolViewer shows 2MC3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.