2X7Z: SAP97 PDZ2 I342W C378A mutant protein domain

Crystal Structure of the SAP97 PDZ2 I342W C378A mutant protein domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 31 Mar 2010.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 826
Mol. weight: 10.57 kDa
Released: 31 Mar 2010

Explore 2X7Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2X7Z contains 3 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	317-323	7	1
β-strand	331-335	5	1
β-strand	337	1	2
β-strand	342	1	3
β-strand	345	1	3
β-strand	348-353	6	1
α-helix	358-362	5
β-strand	370-374	5	1
β-strand	377-378	2	1
β-strand	383	1	2
α-helix	384-392	9
β-strand	397-403	7	1
α-helix	404-405	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 1	A	protein	99	HOMO SAPIENS	Q12959 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2X7Z_1 DISKS LARGE HOMOLOG 1 (chains A)
GSKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHWPGDNSIYVTKIIEGGAAHKDGKLQIG
DKLLAVNNVALEEVTHEEAVTALKNTSDFVYLKVAKPTS

Primary citation

The Plastic Energy Landscape of Protein Folding: A Triangular Folding Mechanism with an Equilibrium Intermediate for a Small Protein Domain. Haq, S.R., Jurgens, M.C., Chi, C.N. et al. J Biol Chem (2010) 285:18051. DOI 10.1074/JBC.M110.110833 · PubMed

Other PDB entries of the same protein (UniProt Q12959 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
4G69 2.0 Å, Structure of the Human Discs Large 1 PDZ2 - Adenomatous Polyposis Coli Cytoskeletal…
8CN1 2.09 Å, hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1
3RL8 2.2 Å, Crystal structure of hDLG1-PDZ2 complexed with APC
3W9Y 2.2 Å, Crystal structure of the human DLG1 guanylate kinase domain
3RL7 2.3 Å, Crystal structure of hDLG1-PDZ1 complexed with APC
4AMH 2.3 Å, Influence of circular permutation on the folding pathway of a PDZ domain
8CN3 2.71 Å, hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1
1PDR 2.8 Å, Crystal structure of the third PDZ domain from the human homolog of discs large protein
3LRA 2.95 Å, Structural Basis for Assembling a Human Tripartite Complex Dlg1-MPP7-Mals3
2M3M Solution structure of a complex consisting of hDlg/SAP-97 residues 318-406 and HPV51…
2OQS Structure of the hDLG/SAP97 PDZ2 in complex with HPV-18 papillomavirus E6 peptide

Browse structure collections

About this viewer

MolViewer shows 2X7Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.