4Q2Q: ZO1 PDZ3

ZO1 PDZ3 in Complex with a Phage-Derived Peptide. Determined by X-ray diffraction at 1.45 Å resolution. Released 10 Sept 2014.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 1
Atoms: 815
Mol. weight: 11.07 kDa
Released: 10 Sept 2014

Explore 4Q2Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Q2Q contains 5 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	421-427	7	1
β-strand	434-438	5	1
β-strand	444-449	6	1
α-helix	454-457	4
α-helix	464	1
β-strand	465-469	5	1
β-strand	472-473	2	1
α-helix	479-488	10
α-helix	490	1
β-strand	494-500	7	1
α-helix	512-514	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tight junction protein ZO-1	A	protein	102	Homo sapiens	Q07157 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4Q2Q_1 Tight junction protein ZO-1 (chains A)
GSHMRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVD
FTNIIREEAVLFLLDLPKGEEVTILAQKKKAAGGGLWFSDWL

Primary citation

A structural portrait of the PDZ domain family. Ernst, A., Appleton, B.A., Ivarsson, Y. et al. J Mol Biol (2014) 426:3509-3519. DOI 10.1016/j.jmb.2014.08.012 · PubMed

Other PDB entries of the same protein (UniProt Q07157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2H2B 1.6 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTYL)
2RCZ 1.7 Å, Structure of the second PDZ domain of ZO-1
9HM2 1.72 Å, A swapped dimeric form of ZO1/TJP1 PDZ2 in complex with the C-terminal peptide from…
4YYX 1.79 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin2 C-terminal…
4OEO 1.9 Å, High resolution crystal structure of the unliganded ZO-1 PDZ1 domain
3TSV 1.99 Å, crystal structure of the third PDZ domain of the human ZO-1 MAGUK protein
2H2C 2.0 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTWV)
4OEP 2.35 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin1 C-terminal…
3CYY 2.4 Å, The crystal structure of ZO-1 PDZ2 in complex with the Cx43 peptide
3TSZ 2.5 Å, crystal structure of PDZ3-SH3-GUK core module from human ZO-1 in complex with 12mer…
3LH5 2.6 Å, Crystal Structure of the SH3-Guanylate kinase core domain of ZO-1
3SHU 2.75 Å, Crystal structure of ZO-1 PDZ3

Browse structure collections

About this viewer

MolViewer shows 4Q2Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.