4OEP: ZO-1 PDZ1 domain

Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin1 C-terminal tail. Determined by X-ray diffraction at 2.35 Å resolution. Released 14 Jan 2015.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,626
Mol. weight: 23.61 kDa
Released: 14 Jan 2015

Explore 4OEP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OEP contains 4 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	17-27	11	1
α-helix	28	1
β-strand	29	1	2
β-strand	33	1	2
β-strand	36-39	4	1
β-strand	54-59	6	1
β-strand	74-78	5	1
β-strand	81-82	2	1
α-helix	88-96	9
β-strand	101-111	11	1

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	18-27	10	1
β-strand	29	1	3
β-strand	33	1	3
β-strand	36-39	4	1
β-strand	54-59	6	1
β-strand	74-78	5	1
β-strand	81-82	2	1
α-helix	88-96	9
β-strand	101-110	10	1
α-helix	116-118	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tight junction protein ZO-1	A, B	protein	107	Homo sapiens	Q07157 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4OEP_1 Tight junction protein ZO-1 (chains A, B)
GSHMIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQEND
RVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKGGGSSGKDYV

Primary citation

Structural Basis of a Key Factor Regulating the Affinity between the Zonula Occludens First PDZ Domain and Claudins. Nomme, J., Antanasijevic, A., Caffrey, M. et al. J Biol Chem (2015) 290:16595-16606. DOI 10.1074/jbc.M115.646695 · PubMed

Other PDB entries of the same protein (UniProt Q07157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q2Q 1.45 Å, ZO1 PDZ3 in Complex with a Phage-Derived Peptide
2H2B 1.6 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTYL)
2RCZ 1.7 Å, Structure of the second PDZ domain of ZO-1
9HM2 1.72 Å, A swapped dimeric form of ZO1/TJP1 PDZ2 in complex with the C-terminal peptide from…
4YYX 1.79 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin2 C-terminal…
4OEO 1.9 Å, High resolution crystal structure of the unliganded ZO-1 PDZ1 domain
3TSV 1.99 Å, crystal structure of the third PDZ domain of the human ZO-1 MAGUK protein
2H2C 2.0 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTWV)
3CYY 2.4 Å, The crystal structure of ZO-1 PDZ2 in complex with the Cx43 peptide
3TSZ 2.5 Å, crystal structure of PDZ3-SH3-GUK core module from human ZO-1 in complex with 12mer…
3LH5 2.6 Å, Crystal Structure of the SH3-Guanylate kinase core domain of ZO-1
3SHU 2.75 Å, Crystal structure of ZO-1 PDZ3

Browse structure collections

About this viewer

MolViewer shows 4OEP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.