High resolution crystal structure of the unliganded ZO-1 PDZ1 domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 14 Jan 2015.
Explore 4OEO in 3D Show helices and sheets RCSB PDB PDBe
4OEO contains 6 α-helices and 20 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-27 | 10 | 1 |
| β-strand | 36-40 | 5 | 1 |
| β-strand | 54-59 | 6 | 1 |
| β-strand | 74-78 | 5 | 1 |
| β-strand | 81-82 | 2 | 1 |
| α-helix | 88-96 | 9 | |
| β-strand | 101-109 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-27 | 10 | 1 |
| α-helix | 28 | 1 | |
| β-strand | 29 | 1 | 2 |
| β-strand | 33 | 1 | 2 |
| β-strand | 36-39 | 4 | 1 |
| β-strand | 54-59 | 6 | 1 |
| α-helix | 73 | 1 | |
| β-strand | 74-78 | 5 | 1 |
| β-strand | 81-82 | 2 | 1 |
| α-helix | 88-96 | 9 | |
| β-strand | 101-109 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19-27 | 9 | 3 |
| β-strand | 36-40 | 5 | 3 |
| β-strand | 54-59 | 6 | 3 |
| α-helix | 73 | 1 | |
| β-strand | 74-78 | 5 | 3 |
| β-strand | 81-82 | 2 | 3 |
| α-helix | 88-96 | 9 | |
| β-strand | 101-109 | 9 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tight junction protein ZO-1 | A, B, C | protein | 107 | Homo sapiens | Q07157 (AlphaFold model) |
>4OEO_1 Tight junction protein ZO-1 (chains A, B, C) GSHMIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQEND RVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKGGGESLTGYV
Structural Basis of a Key Factor Regulating the Affinity between the Zonula Occludens First PDZ Domain and Claudins. Nomme, J., Antanasijevic, A., Caffrey, M. et al. J Biol Chem (2015) 290:16595-16606. DOI 10.1074/jbc.M115.646695 · PubMed
Other PDB entries of the same protein (UniProt Q07157 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4OEO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.