4CGV: First TPR of Spaghetti

First TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD. Determined by X-ray diffraction at 2.54 Å resolution. Released 14 May 2014.

Method: X-ray diffraction
Resolution: 2.54 Å
Organism: HOMO SAPIENS
Chains: 6
Atoms: 4,009
Mol. weight: 63.92 kDa
Released: 14 May 2014

Explore 4CGV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CGV contains 28 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and D: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	130-145	16
α-helix	149-162	14
α-helix	168-179	12
α-helix	183-196	14
α-helix	201-213	13
α-helix	217-230	14
α-helix	235-249	15

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	130-145	16
α-helix	149-162	14
α-helix	168-179	12
α-helix	183-196	14
α-helix	201-213	13
α-helix	217-230	14
α-helix	235-251	17

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	130-145	16
α-helix	149-162	14
α-helix	168-179	12
α-helix	183-196	14
α-helix	201-213	13
α-helix	217-230	14
α-helix	235-247	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II-associated protein 3	A, B, C, D	protein	136	HOMO SAPIENS	Q9H6T3 (AlphaFold model)
Heat shock protein hsp 90-alpha	E, F	protein	7	HOMO SAPIENS	P07900 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4CGV_1 RNA POLYMERASE II-ASSOCIATED PROTEIN 3 (chains A, B, C, D)
ESEEDGIHVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFR
LKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATN
ELRKISQALASKENSY

Sequence of entity 2 (E, F), FASTA

>4CGV_2 HEAT SHOCK PROTEIN HSP 90-ALPHA (chains E, F)
SRMEEVD

Primary citation

Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1. Pal, M., Morgan, M., Phelps, S.E. et al. Structure (2014) 22:805. DOI 10.1016/J.STR.2014.04.001 · PubMed

Other PDB entries of the same protein (UniProt Q9H6T3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZBK 1.49 Å, Crystal structure of the human complex between RPAP3 and TRBP
6FM8 1.78 Å, RPAP3 c-terminus
6GXZ 2.96 Å, Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex
4CGW 3.0 Å, Second TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6FO1 3.57 Å, Human R2TP subcomplex containing 1 RUVBL1-RUVBL2 hexamer bound to 1 RBD domain from RPAP3.
6EZ4 NMR structure of the C-terminal domain of the human RPAP3 protein
6FD7 NMR structure of the first TPR domain of the human RPAP3 protein
6FDP NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP90…
6FDT NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP70…

Browse structure collections

About this viewer

MolViewer shows 4CGV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.