6FDP: Second TPR domain of the human RPAP3 protein

Name: PDB 6FDP: NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP90 peptide DTSRMEEVD
Published: 2018-08-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP90 peptide DTSRMEEVD. Determined by solution NMR. Released 1 Aug 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,012
Mol. weight: 14.45 kDa
Released: 1 Aug 2018

Explore 6FDP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FDP contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	278-294	17
α-helix	298-311	14
α-helix	317-328	12
α-helix	332-345	14
α-helix	350-363	14
α-helix	366-379	14
α-helix	384-392	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II-associated protein 3	A	protein	120	Homo sapiens	Q9H6T3 (AlphaFold model)
Heat shock protein HSP 90-alpha	B	protein	9	Homo sapiens	P07900 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6FDP_1 RNA polymerase II-associated protein 3 (chains A)
GPHMQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAE
KDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEPGNKQAVTELSKIKKK

Sequence of entity 2 (B), FASTA

>6FDP_2 Heat shock protein HSP 90-alpha (chains B)
DTSRMEEVD

Primary citation

Deep Structural Analysis of RPAP3 and PIH1D1, Two Components of the HSP90 Co-chaperone R2TP Complex. Henri, J., Chagot, M.E., Bourguet, M. et al. Structure (2018) 26:1196-1209.e8. DOI 10.1016/j.str.2018.06.002 · PubMed

Other PDB entries of the same protein (UniProt Q9H6T3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZBK 1.49 Å, Crystal structure of the human complex between RPAP3 and TRBP
6FM8 1.78 Å, RPAP3 c-terminus
4CGV 2.54 Å, First TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6GXZ 2.96 Å, Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex
4CGW 3.0 Å, Second TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6FO1 3.57 Å, Human R2TP subcomplex containing 1 RUVBL1-RUVBL2 hexamer bound to 1 RBD domain from RPAP3.
6EZ4 NMR structure of the C-terminal domain of the human RPAP3 protein
6FD7 NMR structure of the first TPR domain of the human RPAP3 protein
6FDT NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP70…

Browse structure collections

About this viewer

MolViewer shows 6FDP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.