6FD7: First TPR domain of the human RPAP3 protein

Name: PDB 6FD7: NMR structure of the first TPR domain of the human RPAP3 protein
Published: 2018-08-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

NMR structure of the first TPR domain of the human RPAP3 protein. Determined by solution NMR. Released 1 Aug 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,019
Mol. weight: 14.49 kDa
Released: 1 Aug 2018

Explore 6FD7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FD7 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	131-146	16
α-helix	149-162	14
α-helix	168-179	12
α-helix	183-196	14
α-helix	201-213	13
α-helix	217-230	14
α-helix	235-251	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II-associated protein 3	A	protein	127	Homo sapiens	Q9H6T3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6FD7_1 RNA polymerase II-associated protein 3 (chains A)
GPHMALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAES
DCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQAL
ASKENSY

Primary citation

Deep Structural Analysis of RPAP3 and PIH1D1, Two Components of the HSP90 Co-chaperone R2TP Complex. Henri, J., Chagot, M.E., Bourguet, M. et al. Structure (2018) 26:1196-1209.e8. DOI 10.1016/j.str.2018.06.002 · PubMed

Other PDB entries of the same protein (UniProt Q9H6T3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZBK 1.49 Å, Crystal structure of the human complex between RPAP3 and TRBP
6FM8 1.78 Å, RPAP3 c-terminus
4CGV 2.54 Å, First TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6GXZ 2.96 Å, Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex
4CGW 3.0 Å, Second TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6FO1 3.57 Å, Human R2TP subcomplex containing 1 RUVBL1-RUVBL2 hexamer bound to 1 RBD domain from RPAP3.
6EZ4 NMR structure of the C-terminal domain of the human RPAP3 protein
6FDP NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP90…
6FDT NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP70…

Browse structure collections

About this viewer

MolViewer shows 6FD7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.