6FM8: RPAP3 c-terminus

RPAP3 c-terminus. Determined by X-ray diffraction at 1.78 Å resolution. Released 13 Mar 2019.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Homo sapiens
Chains: 1
Atoms: 443
Mol. weight: 6.15 kDa
Released: 13 Mar 2019

Explore 6FM8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FM8 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	580-585	6
α-helix	588-604	17
α-helix	609-623	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II-associated protein 3	A	protein	50	Homo sapiens	Q9H6T3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6FM8_1 RNA polymerase II-associated protein 3 (chains A)
SLYPKLFQKNLDPDVFNQIVKILHDFYIEKEKPLLIFEILQRLSELKRFD

Primary citation

RPAP3 provides a flexible scaffold for coupling HSP90 to the human R2TP co-chaperone complex. Pal, M., Roe, S.M. Nat Commun (2020). DOI 10.1038/s41467-018-03942-1

Other PDB entries of the same protein (UniProt Q9H6T3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZBK 1.49 Å, Crystal structure of the human complex between RPAP3 and TRBP
4CGV 2.54 Å, First TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6GXZ 2.96 Å, Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex
4CGW 3.0 Å, Second TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6FO1 3.57 Å, Human R2TP subcomplex containing 1 RUVBL1-RUVBL2 hexamer bound to 1 RBD domain from RPAP3.
6EZ4 NMR structure of the C-terminal domain of the human RPAP3 protein
6FD7 NMR structure of the first TPR domain of the human RPAP3 protein
6FDP NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP90…
6FDT NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP70…

Browse structure collections

About this viewer

MolViewer shows 6FM8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.