4CGW: Second TPR of Spaghetti

Second TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD. Determined by X-ray diffraction at 3.0 Å resolution. Released 14 May 2014.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 1,798
Mol. weight: 28.02 kDa
Released: 14 May 2014

Explore 4CGW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CGW contains 14 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	268-277	10
α-helix	278-280	3
α-helix	281-294	14
α-helix	298-310	13
α-helix	317-328	12
α-helix	333-345	13
α-helix	350-363	14
α-helix	366-379	14

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	281-294	14
α-helix	298-311	14
α-helix	317-327	11
α-helix	332-345	14
α-helix	350-363	14
α-helix	366-379	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II-associated protein 3	A, B	protein	117	HOMO SAPIENS	Q9H6T3 (AlphaFold model)
Heat shock protein hsp 90-alpha	C, D	protein	7	HOMO SAPIENS	P07900 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4CGW_1 RNA POLYMERASE II-ASSOCIATED PROTEIN 3 (chains A, B)
STEGERKQIEAQQNKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAM
AYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEP

Sequence of entity 2 (C, D), FASTA

>4CGW_2 HEAT SHOCK PROTEIN HSP 90-ALPHA (chains C, D)
SRMEEVD

Primary citation

Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1. Pal, M., Morgan, M., Phelps, S.E. et al. Structure (2014) 22:805. DOI 10.1016/J.STR.2014.04.001 · PubMed

Other PDB entries of the same protein (UniProt Q9H6T3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZBK 1.49 Å, Crystal structure of the human complex between RPAP3 and TRBP
6FM8 1.78 Å, RPAP3 c-terminus
4CGV 2.54 Å, First TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6GXZ 2.96 Å, Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex
6FO1 3.57 Å, Human R2TP subcomplex containing 1 RUVBL1-RUVBL2 hexamer bound to 1 RBD domain from RPAP3.
6EZ4 NMR structure of the C-terminal domain of the human RPAP3 protein
6FD7 NMR structure of the first TPR domain of the human RPAP3 protein
6FDP NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP90…
6FDT NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP70…

Browse structure collections

About this viewer

MolViewer shows 4CGW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.