6EZ4: C-terminal domain of the human RPAP3 protein

Name: PDB 6EZ4: NMR structure of the C-terminal domain of the human RPAP3 protein
Published: 2018-04-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

NMR structure of the C-terminal domain of the human RPAP3 protein. Determined by solution NMR. Released 18 Apr 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,113
Mol. weight: 15.8 kDa
Released: 18 Apr 2018

Explore 6EZ4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EZ4 contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	534-539	6
α-helix	543-546	4
α-helix	549-559	11
α-helix	563-572	10
α-helix	578-581	4
α-helix	588-597	10
α-helix	598-602	5
α-helix	603-605	3
α-helix	608-619	12
α-helix	624-630	7
α-helix	633-648	16
α-helix	654-664	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II-associated protein 3	A	protein	135	Homo sapiens	Q9H6T3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6EZ4_1 RNA polymerase II-associated protein 3 (chains A)
GPHMAQFATTVLPPIPANSFQLESDFRQLKSSPDMLYQYLKQIEPSLYPKLFQKNLDPDV
FNQIVKILHDFYIEKEKPLLIFEILQRLSELKRFDMAVMFMSETEKKIARALFNHIDKSG
LKDSSVEELKKRYGG

Primary citation

The RPAP3-Cterminal domain identifies R2TP-like quaternary chaperones. Maurizy, C., Quinternet, M., Abel, Y. et al. Nat Commun (2018) 9:2093-2093. DOI 10.1038/s41467-018-04431-1 · PubMed

Other PDB entries of the same protein (UniProt Q9H6T3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZBK 1.49 Å, Crystal structure of the human complex between RPAP3 and TRBP
6FM8 1.78 Å, RPAP3 c-terminus
4CGV 2.54 Å, First TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6GXZ 2.96 Å, Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex
4CGW 3.0 Å, Second TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6FO1 3.57 Å, Human R2TP subcomplex containing 1 RUVBL1-RUVBL2 hexamer bound to 1 RBD domain from RPAP3.
6FD7 NMR structure of the first TPR domain of the human RPAP3 protein
6FDP NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP90…
6FDT NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP70…

Browse structure collections

About this viewer

MolViewer shows 6EZ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.