4DAY: RMI core complex with MM2 peptide from FANCM

Crystal structure of the RMI core complex with MM2 peptide from FANCM. Determined by X-ray diffraction at 3.3 Å resolution. Released 14 Mar 2012.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,098
Mol. weight: 37.77 kDa
Released: 14 Mar 2012

Explore 4DAY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DAY contains 12 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	492	1	1
α-helix	494-500	7
β-strand	506-517	12	1
α-helix	520-521	2
β-strand	522	1	2
α-helix	524-526	3
β-strand	529	1	2
β-strand	532-535	4	1
β-strand	540-545	6	1
α-helix	547-554	8
α-helix	558-566	9
α-helix	568-586	19
β-strand	589-596	8	1
β-strand	603-609	7	1
α-helix	610-611	2
α-helix	613-622	10

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	21-22	2
β-strand	23-24	2	3
α-helix	27-32	6
β-strand	57-68	12	3
β-strand	71-75	5	3
β-strand	80-84	5	3
α-helix	86-88	3
β-strand	101-108	8	3
β-strand	116-124	9	3
α-helix	130-144	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RecQ-mediated genome instability protein 1	A	protein	157	Homo sapiens	Q9H9A7 (AlphaFold model)
RecQ-mediated genome instability protein 2	B	protein	150	Homo sapiens	Q96E14 (AlphaFold model)
Fanconi anemia group M protein	C	protein	37	Homo sapiens	Q8IYD8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4DAY_1 RecQ-mediated genome instability protein 1 (chains A)
GSHMSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIW
SITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDL
CCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK

Sequence of entity 2 (B), FASTA

>4DAY_2 RecQ-mediated genome instability protein 2 (chains B)
GSHMAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAA
VWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCL
QAVKMTDLSDNPIHESMWELEVEDLHRNIP

Sequence of entity 3 (C), FASTA

>4DAY_3 Fanconi anemia group M protein (chains C)
GHMEDIFDCSRDLFSVTFDLGFCSPDSDDEILEHTSD

Primary citation

Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome. Hoadley, K.A., Xue, Y., Ling, C. et al. Proc Natl Acad Sci U S A (2012) 109:4437-4442. DOI 10.1073/pnas.1117279109 · PubMed

Other PDB entries of the same protein (UniProt Q9H9A7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MXN 1.55 Å, Crystal structure of the RMI core complex
7XUV 1.6 Å, Crystal structure of RPA70N-RMI1 fusion
3NBH 2.0 Å, Crystal structure of human RMI1C-RMI2 complex
3NBI 2.0 Å, Crystal structure of human RMI1 N-terminus
9PFD 2.01 Å, RMI1-RMI2 bound to synthetic peptide P4Ser
9DHK 2.35 Å, RMI1-RMI2 bound to cyclic peptide L3
9DI4 2.7 Å, RMI1-RMI2 bound to cyclic peptide L4
4CGY 2.85 Å, Crystal structure of the human topoisomerase III alpha-RMI1 complex
4CHT 3.25 Å, Crystal structure of the human topoisomerase III alpha-RMI1 complex with bound calcium ion

Browse structure collections

About this viewer

MolViewer shows 4DAY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.