4G69: Disks large homolog 1

Structure of the Human Discs Large 1 PDZ2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Dec 2012.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 875
Mol. weight: 11.81 kDa
Released: 12 Dec 2012

Explore 4G69 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4G69 contains 2 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	315-323	9	1
β-strand	325	1	2
β-strand	328	1	2
β-strand	331-335	5	1
β-strand	337	1	3
β-strand	342	1	4
β-strand	345	1	4
β-strand	348-353	6	1
α-helix	358-362	5
β-strand	370-374	5	1
β-strand	377-378	2	1
β-strand	383	1	3
α-helix	384-392	9
β-strand	397-405	9	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2841-2842	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 1	A	protein	100	Homo sapiens	Q12959 (AlphaFold model)
Adenomatous polyposis coli protein	B	protein	11	Homo sapiens	P25054

Sequence of entity 1 (A), FASTA

>4G69_1 Disks large homolog 1 (chains A)
GSRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQI
GDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTS

Sequence of entity 2 (B), FASTA

>4G69_2 Adenomatous polyposis coli protein (chains B)
RHSGSYLVTSV

Primary citation

Structure of the Human Discs Large 1 PDZ2- Adenomatous Polyposis Coli Cytoskeletal Polarity Complex: Insight into Peptide Engagement and PDZ Clustering. Slep, K.C. PLoS One (2012) 7:e50097-e50097. DOI 10.1371/journal.pone.0050097 · PubMed

Other PDB entries of the same protein (UniProt Q12959 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
2X7Z 2.0 Å, Crystal Structure of the SAP97 PDZ2 I342W C378A mutant protein domain
8CN1 2.09 Å, hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1
3RL8 2.2 Å, Crystal structure of hDLG1-PDZ2 complexed with APC
3W9Y 2.2 Å, Crystal structure of the human DLG1 guanylate kinase domain
3RL7 2.3 Å, Crystal structure of hDLG1-PDZ1 complexed with APC
4AMH 2.3 Å, Influence of circular permutation on the folding pathway of a PDZ domain
8CN3 2.71 Å, hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1
1PDR 2.8 Å, Crystal structure of the third PDZ domain from the human homolog of discs large protein
3LRA 2.95 Å, Structural Basis for Assembling a Human Tripartite Complex Dlg1-MPP7-Mals3
2M3M Solution structure of a complex consisting of hDlg/SAP-97 residues 318-406 and HPV51…
2OQS Structure of the hDLG/SAP97 PDZ2 in complex with HPV-18 papillomavirus E6 peptide

Browse structure collections

About this viewer

MolViewer shows 4G69 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.