4JTC: Kv1.2-2.1 paddle chimera channel

Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+. Determined by X-ray diffraction at 2.56 Å resolution. Released 12 Jun 2013.

Method: X-ray diffraction
Resolution: 2.56 Å
Organisms: Rattus norvegicus, Leiurus quinquestriatus hebraeus
Chains: 5
Atoms: 11,770
Mol. weight: 211.94 kDa
Ligands: PGW, CS, NAP
Released: 12 Jun 2013

Explore 4JTC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JTC contains 89 α-helices and 39 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	1
β-strand	48-50	3	1
β-strand	52-55	4	2
α-helix	59-63	5
α-helix	66-78	13
β-strand	83-87	5	2
α-helix	94-106	13
α-helix	110-112	3
β-strand	114-119	6	2
β-strand	121	1	3
α-helix	126-128	3
β-strand	129	1	3
α-helix	133-147	15
β-strand	152-157	6	2
α-helix	166-178	13
β-strand	182-188	7	2
α-helix	192-205	14
α-helix	208-210	3
β-strand	212-214	3	2
β-strand	216	1	2
β-strand	218	1	4
β-strand	221	1	4
α-helix	223	1
α-helix	224-228	5
α-helix	229-236	8
β-strand	239-243	5	2
α-helix	247-252	6
α-helix	264-266	3
α-helix	271-278	8
α-helix	280-299	20
α-helix	303-311	9
β-strand	317-322	6	2
α-helix	327-333	7
α-helix	336-339	4
α-helix	340-342	3
α-helix	345-355	11
α-helix	358-360	3

Chain B: 22 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	34-39	6	5
β-strand	42-47	6	5
α-helix	48-51	4
α-helix	62-65	4
α-helix	66-68	3
β-strand	69-70	2	5
β-strand	75-78	4	5
α-helix	82-94	13
α-helix	106-115	10
α-helix	120-129	10
α-helix	146-149	4
α-helix	160-182	23
α-helix	186-189	4
α-helix	202-210	9
α-helix	221-242	22
α-helix	247-252	6
α-helix	254-261	8
α-helix	264-275	12
α-helix	279-282	4
α-helix	286-294	9
α-helix	295-305	11
α-helix	308-319	12
α-helix	321-345	25
α-helix	357-368	12
α-helix	381-399	19
α-helix	401-414	14

Chain G: 22 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	6
β-strand	48-50	3	6
β-strand	52-55	4	7
α-helix	59-63	5
α-helix	66-78	13
β-strand	83-87	5	7
α-helix	90-93	4
α-helix	94-106	13
α-helix	110-112	3
β-strand	114-119	6	7
β-strand	121	1	8
α-helix	126-128	3
β-strand	129	1	8
α-helix	133-147	15
β-strand	152-157	6	7
α-helix	166-178	13
β-strand	182-188	7	7
α-helix	192-205	14
α-helix	208-210	3
β-strand	212-216	5	7
β-strand	218	1	9
β-strand	221	1	9
α-helix	223	1
α-helix	224-228	5
α-helix	229-236	8
β-strand	239-243	5	7
α-helix	247-252	6
α-helix	264-266	3
α-helix	271-278	8
α-helix	280-299	20
α-helix	303-311	9
β-strand	317-322	6	7
α-helix	327-334	8
α-helix	336-339	4
α-helix	345-355	11
α-helix	358-360	3

Chain H: 21 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	34-39	6	10
β-strand	42-47	6	10
α-helix	48-51	4
α-helix	62-65	4
α-helix	66-68	3
β-strand	69-70	2	10
β-strand	75-78	4	10
α-helix	82-94	13
α-helix	99-101	3
α-helix	106-115	10
α-helix	120-128	9
α-helix	151-154	4
α-helix	160-181	22
α-helix	221-237	17
α-helix	248-250	3
α-helix	254-256	3
α-helix	257-260	4
α-helix	264-267	4
α-helix	287-290	4
α-helix	296-302	7
α-helix	308-318	11
α-helix	323-345	23
α-helix	357-368	12
α-helix	383-397	15
α-helix	401-413	13

Chain Y: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
α-helix	14-20	7
β-strand	28	1	11
β-strand	33	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-gated potassium channel subunit beta-2	A, G	protein	333	Rattus norvegicus	P62483 (AlphaFold model)
Potassium voltage-gated channel subfamily A member 2, Potassium voltage-gated channel subfamily B…	B, H	protein	514	Rattus norvegicus	P15387 (AlphaFold model), P63142 (AlphaFold model)
Potassium channel toxin alpha-KTx 1.1	Y	protein	37	Leiurus quinquestriatus hebraeus	P13487 (AlphaFold model)

Sequence of entity 1 (A, G), FASTA

>4JTC_1 Voltage-gated potassium channel subunit beta-2 (chains A, G)
MLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGK
AEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDV
VFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQ
AEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLK
DKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENI
GAIQVLPKLSSSIVHEIDSILGNKPYSKKDYRS

Sequence of entity 2 (B, H), FASTA

>4JTC_2 Potassium voltage-gated channel subfamily A member 2, Potassium voltage-gated channel subfamily B member 1 (chains B, H)
MAHHHHHHHHHHGLVPRGSMTVATGDPVDEAAALPGHPQDTYDPEADHESSERVVINISG
LRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRP
VNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGP
ARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSQSTIGYQQSTSFTDP
FFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYYVTIFLTESNKSVLQ
FQNVRRVVQIFRIMRILRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSA
VYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALP
VPVIVSNFNYFYHRETEGEEQAQYLQVTSSPKIPSSPDLKKSRSASTISKSDYMEIQEGV
NNSNEDFREENLKTANSTLANTNYVNITKMLTDV

Sequence of entity 3 (Y), FASTA

>4JTC_3 Potassium channel toxin alpha-KTx 1.1 (chains Y)
QFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS

Ligands and cofactors

ID	Name	Formula	Copies
PGW	(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexade…	C40 H77 O10 P	17
CS	Cesium ion	Cs	8
NAP	NADP nicotinamide-adenine-dinucleotide phosphate	C21 H28 N7 O17 P3	2

Primary citation

Structure of a pore-blocking toxin in complex with a eukaryotic voltage-dependent K(+) channel. Banerjee, A., Lee, A., Campbell, E. et al. Elife (2013) 2:e00594-e00594. DOI 10.7554/eLife.00594 · PubMed

Other PDB entries of the same protein (UniProt P62483 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EAU 1.82 Å, Voltage-dependent K+ channel beta subunit in complex with cortisone
3EB3 2.0 Å, Voltage-dependent K+ channel beta subunit (W121A) in complex with cortisone
3EB4 2.0 Å, Voltage-dependent K+ channel beta subunit (I211R) in complex with cortisone
1EXB 2.1 Å, Structure of the cytoplasmic beta subunit-T1 assembly of voltage-dependent K channels
2R9R 2.4 Å, Shaker family voltage dependent potassium channel (kv1.2-kv2.1 paddle chimera channel)…
4JTA 2.5 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin
4JTD 2.54 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of…
1QRQ 2.8 Å, Structure of a voltage-dependent K+ channel beta subunit
2A79 2.9 Å, Mammalian Shaker Kv1.2 potassium channel- beta subunit complex
3LNM 2.9 Å, F233W mutant of the Kv2.1 paddle-Kv1.2 chimera channel
3LUT 2.9 Å, A Structural Model for the Full-length Shaker Potassium Channel Kv1.2
6EBL 3.0 Å, The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic…

Browse structure collections

About this viewer

MolViewer shows 4JTC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.