6VWB: Crossover junction endonuclease MUS81

Solution structure of the N-terminal helix-hairpin-helix domain of human MUS81. Determined by solution NMR. Released 24 Feb 2021.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 747
Mol. weight: 10.62 kDa
Released: 24 Feb 2021

Explore 6VWB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6VWB contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	10	1
α-helix	13	1
α-helix	19-35	17
α-helix	39-52	14
α-helix	61-64	4
α-helix	71-87	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Crossover junction endonuclease MUS81	A	protein	90	Homo sapiens	Q96NY9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6VWB_1 Crossover junction endonuclease MUS81 (chains A)
AAAPVRLGRKRPLPACPNPLFVRWLTEWRDEATRSRRRTRFVFQKALRSLRRYPLPLRSG
KEAKILQHFGDGLCRMLDERLQRHRTSGGD

Primary citation

Phosphorylation of the DNA repair scaffold SLX4 drives folding of the SAP domain and activation of the MUS81-EME1 endonuclease. Payliss, B., Houliston, S., Lemak, A. et al. Cell Rep (2022) 41.

Other PDB entries of the same protein (UniProt Q96NY9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BU5 1.8 Å, Crystal Structure of Human SLX4 and MUS81
9F9L 2.02 Å, Crystal structure of MUS81-EME1 bound by compound 16.
9F98 2.15 Å, Crystal structure of MUS81-EME1, apo form.
9F9M 2.47 Å, Crystal structure of MUS81-EME1 bound by compound 21.
9F9K 2.73 Å, Crystal structure of MUS81-EME1 bound by compound 15.
4P0P 2.8 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA, and Mg2+
9F99 2.8 Å, Crystal structure of MUS81-EME1 bound by compound 10.
4P0Q 2.85 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA
9F9A 2.91 Å, Crystal structure of MUS81-EME1 bound by compound 12.
7F6L 3.2 Å, Crystal structure of human MUS81-EME2 complex
2ZIX 3.5 Å, Crystal structure of the Mus81-Eme1 complex
4P0S 6.0 Å, human Mus81-Eme1-3'flap DNA complex

Browse structure collections

About this viewer

MolViewer shows 6VWB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.