7DWX: Conformation 1 of S-ACE2-B0AT1 ternary complex

Conformation 1 of S-ACE2-B0AT1 ternary complex. Determined by electron microscopy at 8.3 Å resolution. Released 31 Mar 2021.

Method: Electron microscopy
Resolution: 8.3 Å
Organisms: Homo sapiens, Severe acute respiratory syndrome coronavirus 2
Chains: 10
Atoms: 71,532
Mol. weight: 1228.7 kDa
Ligands: ZN, LEU, NAG
Released: 31 Mar 2021

Explore 7DWX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DWX contains 311 α-helices and 462 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 33 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
α-helix	38-48	11
α-helix	58-64	7
α-helix	71-77	7
α-helix	78-82	5
α-helix	83-96	14
α-helix	101-104	4
α-helix	113-141	29
β-strand	155	1	1
β-strand	162	1	1
α-helix	164-168	5
α-helix	173-175	3
α-helix	176-180	5
α-helix	196-211	16
α-helix	219-241	23
α-helix	251-255	5
α-helix	259-263	5
α-helix	266-278	13
α-helix	285-290	6
α-helix	301-316	16
α-helix	318-345	28
α-helix	360-370	11
α-helix	403-407	5
α-helix	415-429	15
α-helix	431-444	14
α-helix	455-469	15
α-helix	470-473	4
α-helix	478-504	27
α-helix	505-510	6
α-helix	511-521	11
α-helix	528-532	5
α-helix	533-537	5
α-helix	538-545	8
α-helix	547-553	7
β-strand	559-562	4	2
β-strand	574-577	4	2
α-helix	582-608	27

Chains B and D: 43 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	22-52	31
α-helix	59-80	22
α-helix	91-101	11
α-helix	110-128	19
β-strand	132-134	3	3
β-strand	137-142	6	3
α-helix	148-154	7
α-helix	158-192	35
α-helix	199-203	5
α-helix	204-207	4
β-strand	209	1	4
β-strand	217	1	4
α-helix	221-230	10
α-helix	234-251	18
β-strand	260	1	5
α-helix	261	1
β-strand	262-263	2	6
α-helix	276-278	3
α-helix	279-282	4
α-helix	289-291	3
α-helix	295-298	4
α-helix	304-318	15
α-helix	321-323	3
α-helix	327-330	4
β-strand	332	1	7
β-strand	347-352	6	7
β-strand	355-359	5	7
α-helix	366-382	17
α-helix	390-392	3
α-helix	400-412	13
α-helix	415-420	6
α-helix	432-443	12
α-helix	450-465	16
α-helix	470-472	3
α-helix	473-480	8
α-helix	481-485	5
β-strand	487-488	2	6
α-helix	500-502	3
α-helix	504-507	4
α-helix	514-532	19
α-helix	539-541	3
α-helix	549-558	10
α-helix	566-571	6
α-helix	582-587	6
α-helix	589-598	10
β-strand	607	1	5
β-strand	618-622	5	8
α-helix	624-627	4
α-helix	632-634	3
α-helix	637-657	21
α-helix	667-669	3
β-strand	670-673	4	8
β-strand	680-685	6	8
β-strand	686	1	9
β-strand	694	1	9
α-helix	695-696	2
α-helix	697-706	10
α-helix	708-715	8
β-strand	722-724	3	8
α-helix	741-765	25

Chain E: 28 helices, 68 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	19
β-strand	37	1	20
β-strand	49-55	7	21
β-strand	61-65	5	19
β-strand	84-85	2	22
β-strand	90-92	3	23
β-strand	94	1	19
β-strand	95	1	23
β-strand	101	1	24
β-strand	105	1	25
β-strand	106-107	2	22
β-strand	116-121	6	25
β-strand	126-135	10	25
β-strand	141	1	26
β-strand	160-169	10	25
β-strand	189-197	9	23
β-strand	200-208	9	23
α-helix	222	1
β-strand	223	1	20
β-strand	224-230	7	23
β-strand	237-238	2	22
β-strand	242	1	24
β-strand	243	1	26
β-strand	265-267	3	19
β-strand	268-269	2	23
β-strand	271-279	9	21
β-strand	285-290	6	21
α-helix	295-303	9
α-helix	308-309	2
β-strand	311-319	9	27
β-strand	323-328	6	28
α-helix	339-343	5
β-strand	356-358	3	29
α-helix	365-369	5
β-strand	376-379	4	29
α-helix	384-389	6
β-strand	394-402	9	29
α-helix	407-409	3
α-helix	417-421	5
β-strand	432-437	6	29
α-helix	439-442	4
β-strand	448-454	7	30
α-helix	460-462	3
β-strand	492-497	6	30
β-strand	508-516	9	29
α-helix	526-529	4
β-strand	539-543	5	28
β-strand	546-550	5	28
β-strand	551-554	4	31
β-strand	566-567	2	31
β-strand	573-577	5	31
β-strand	584-588	5	31
α-helix	589-590	2
β-strand	592-599	8	27
β-strand	609-613	5	27
β-strand	642-645	4	27
β-strand	648-651	4	27
β-strand	654-655	2	32
β-strand	664-667	4	32
β-strand	670-673	4	32
β-strand	693-696	4	32
β-strand	711-728	18	33
β-strand	733-736	4	34
α-helix	738-742	5
α-helix	747-753	7
α-helix	754-756	3
α-helix	759-782	24
β-strand	788-790	3	35
β-strand	797	1	36
β-strand	800	1	36
β-strand	807	1	37
α-helix	812-814	3
β-strand	816	1	37
α-helix	817-825	9
β-strand	858-861	4	34
α-helix	862-863	2
α-helix	867-884	18
α-helix	898-908	11
α-helix	913-917	5
α-helix	920-939	20
α-helix	946-963	18
α-helix	977-980	4
α-helix	986-1028	43
α-helix	1029-1033	5
β-strand	1047-1056	10	33
β-strand	1059-1078	20	33
β-strand	1081-1083	3	38
β-strand	1086-1090	5	38
β-strand	1094-1097	4	33
β-strand	1102-1106	5	33
β-strand	1109-1114	6	33
β-strand	1116	1	39
β-strand	1120-1125	6	38
β-strand	1133-1134	2	38
β-strand	1138	1	39
α-helix	1141-1145	5

Chains F and I: 25 helices, 72 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	40
β-strand	37	1	41
β-strand	43	1	31
β-strand	49-55	7	42
β-strand	61-65	5	40
β-strand	84-85	2	43
β-strand	90-92	3	44
β-strand	94	1	40
β-strand	95	1	44
β-strand	101	1	45
β-strand	105	1	46
β-strand	106-107	2	43
β-strand	116-121	6	46
β-strand	126-135	10	46
β-strand	141	1	47
β-strand	160-169	10	46
β-strand	189-197	9	44
β-strand	200-208	9	44
α-helix	222	1
β-strand	223	1	41
β-strand	224-230	7	44
β-strand	237-238	2	43
β-strand	242	1	45
β-strand	243	1	47
β-strand	265-267	3	40
β-strand	268-269	2	44
β-strand	271-279	9	42
β-strand	285-290	6	42
α-helix	295-303	9
α-helix	308	1
β-strand	309-316	8	48
β-strand	319	1	49
β-strand	323	1	50
β-strand	356-358	3	51
α-helix	365-369	5
β-strand	376-379	4	51
β-strand	395-402	8	51
α-helix	407-409	3
β-strand	412	1	52
α-helix	417-421	5
β-strand	425	1	52
β-strand	432-437	6	51
α-helix	439-442	4
β-strand	448-454	7	53
α-helix	460-462	3
α-helix	471-472	2
β-strand	473-474	2	54
β-strand	485	1	54
β-strand	488-489	2	54
β-strand	492-497	6	53
β-strand	508-514	7	51
β-strand	539-543	5	50
β-strand	546-550	5	50
β-strand	551-554	4	55
β-strand	566-567	2	55
β-strand	573-577	5	55
β-strand	584-588	5	55
α-helix	589-591	3
β-strand	592	1	49
β-strand	595-601	7	48
β-strand	609-612	4	48
β-strand	642-645	4	48
β-strand	648-651	4	48
β-strand	654-655	2	56
β-strand	664-667	4	56
β-strand	670-673	4	56
β-strand	693-696	4	56
α-helix	697-698	2
β-strand	702-704	3	57
β-strand	711-728	18	58
β-strand	733-736	4	59
α-helix	738-742	5
α-helix	748-753	6
α-helix	754-756	3
α-helix	759-782	24
α-helix	817-822	6
β-strand	858-861	4	59
α-helix	862-863	2
α-helix	867-884	18
α-helix	898-908	11
α-helix	914-917	4
α-helix	920-938	19
α-helix	946-964	19
α-helix	986-1028	43
α-helix	1029-1033	5
β-strand	1047-1056	10	58
β-strand	1059-1078	20	58
β-strand	1081-1083	3	60
β-strand	1086-1090	5	60
β-strand	1094-1097	4	58
β-strand	1102-1105	4	58
β-strand	1113	1	58
β-strand	1116	1	61
β-strand	1120-1122	3	60
β-strand	1133-1134	2	60
β-strand	1138	1	61
α-helix	1141-1144	4

Chains G and J: 27 helices, 70 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	62
β-strand	37	1	63
β-strand	49-55	7	64
β-strand	61-65	5	62
β-strand	84-85	2	65
β-strand	90-92	3	66
β-strand	94	1	62
β-strand	95	1	66
β-strand	101	1	67
β-strand	105	1	68
β-strand	106-107	2	65
β-strand	116-121	6	68
β-strand	126-135	10	68
β-strand	141	1	69
β-strand	160-169	10	68
β-strand	189-197	9	66
β-strand	200-208	9	66
α-helix	222	1
β-strand	223	1	63
β-strand	224-230	7	66
β-strand	237-238	2	65
β-strand	242	1	67
β-strand	243	1	69
β-strand	265-267	3	62
β-strand	268-269	2	66
β-strand	271-279	9	64
β-strand	285-290	6	64
α-helix	295-303	9
α-helix	308-309	2
β-strand	311-317	7	70
β-strand	327	1	71
β-strand	356-358	3	72
β-strand	362	1	73
α-helix	365-369	5
β-strand	376-379	4	72
α-helix	384-389	6
β-strand	395-402	8	72
α-helix	407-409	3
α-helix	417-421	5
β-strand	432-437	6	72
α-helix	439-442	4
β-strand	448-454	7	74
α-helix	460-462	3
α-helix	471-472	2
β-strand	473-474	2	75
β-strand	485	1	75
β-strand	488-489	2	75
β-strand	492-497	6	74
β-strand	508-515	8	72
β-strand	525	1	73
β-strand	530	1	71
β-strand	539-543	5	76
β-strand	546-550	5	76
β-strand	554	1	77
β-strand	575-577	3	77
β-strand	584-586	3	77
α-helix	589-591	3
β-strand	594-599	6	70
β-strand	609-613	5	70
β-strand	642-645	4	70
β-strand	648-651	4	70
β-strand	654-655	2	78
β-strand	664-665	2	78
β-strand	670-673	4	78
β-strand	693-696	4	78
β-strand	702-704	3	35
β-strand	711-728	18	79
β-strand	733-736	4	80
α-helix	738-742	5
α-helix	747-753	7
α-helix	754-756	3
α-helix	759-782	24
β-strand	788-790	3	57
α-helix	817-825	9
β-strand	858-861	4	80
α-helix	862-863	2
α-helix	867-884	18
α-helix	898-907	10
α-helix	914-917	4
α-helix	920-938	19
α-helix	946-964	19
α-helix	965-967	3
α-helix	978-981	4
α-helix	986-1028	43
α-helix	1029-1033	5
β-strand	1047-1056	10	79
β-strand	1059-1078	20	79
β-strand	1081-1083	3	81
β-strand	1086-1090	5	81
β-strand	1094-1097	4	79
β-strand	1102-1105	4	79
β-strand	1113	1	79
β-strand	1116	1	82
β-strand	1120-1122	3	81
β-strand	1133-1134	2	81
β-strand	1138	1	82
α-helix	1141-1145	5

Chain H: 27 helices, 68 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	83
β-strand	37	1	84
β-strand	49-55	7	85
β-strand	61-65	5	83
β-strand	84-85	2	86
β-strand	90-92	3	87
β-strand	94	1	83
β-strand	95	1	87
β-strand	101	1	88
β-strand	105	1	89
β-strand	106-107	2	86
β-strand	116-121	6	89
β-strand	126-135	10	89
β-strand	141	1	90
β-strand	160-169	10	89
β-strand	189-197	9	87
β-strand	200-208	9	87
α-helix	222	1
β-strand	223	1	84
β-strand	224-230	7	87
β-strand	237-238	2	86
β-strand	242	1	88
β-strand	243	1	90
β-strand	265-267	3	83
β-strand	268-269	2	87
β-strand	271-279	9	85
β-strand	285-290	6	85
α-helix	295-303	9
α-helix	308-309	2
β-strand	311-319	9	91
β-strand	323-328	6	92
α-helix	339-343	5
β-strand	356-358	3	93
α-helix	365-369	5
β-strand	376-379	4	93
α-helix	384-389	6
β-strand	394-402	9	93
α-helix	407-409	3
α-helix	417-421	5
β-strand	432-437	6	93
α-helix	439-442	4
β-strand	448-454	7	94
α-helix	460-462	3
β-strand	492-497	6	94
β-strand	508-516	9	93
β-strand	539-543	5	92
β-strand	546-550	5	92
β-strand	551-554	4	95
β-strand	566-567	2	95
β-strand	573-577	5	95
β-strand	584-588	5	95
α-helix	589-590	2
β-strand	592-599	8	91
β-strand	609-613	5	91
β-strand	642-645	4	91
β-strand	648-651	4	91
β-strand	654-655	2	96
β-strand	664-667	4	96
β-strand	670-673	4	96
β-strand	693-696	4	96
β-strand	711-728	18	97
β-strand	733-736	4	98
α-helix	738-742	5
α-helix	747-753	7
α-helix	754-756	3
α-helix	759-782	24
β-strand	788-790	3	99
β-strand	797	1	100
β-strand	800	1	100
β-strand	807	1	101
α-helix	812-814	3
β-strand	816	1	101
α-helix	817-825	9
β-strand	858-861	4	98
α-helix	862-863	2
α-helix	867-884	18
α-helix	898-908	11
α-helix	913-917	5
α-helix	920-939	20
α-helix	946-963	18
α-helix	977-980	4
α-helix	986-1028	43
α-helix	1029-1033	5
β-strand	1047-1056	10	97
β-strand	1059-1078	20	97
β-strand	1081-1083	3	102
β-strand	1086-1090	5	102
β-strand	1094-1097	4	97
β-strand	1102-1106	5	97
β-strand	1109-1114	6	97
β-strand	1116	1	103
β-strand	1120-1125	6	102
β-strand	1133-1134	2	102
β-strand	1138	1	103
α-helix	1141-1145	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium-dependent neutral amino acid transporter B(0)AT1	A, C	protein	654	Homo sapiens	Q695T7 (AlphaFold model)
Angiotensin-converting enzyme 2	B, D	protein	817	Homo sapiens	Q9BYF1 (AlphaFold model)
Spike glycoprotein	E, F, G, H, I, J	protein	1283	Severe acute respiratory syndrome coronavirus 2	P0DTC2 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7DWX_1 Sodium-dependent neutral amino acid transporter B(0)AT1 (chains A, C)
MADYKDDDDKSGPDEVDASGRVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNKAQ
YMLTCLGFCVGLGNVWRFPYLCQSHGGGAFMIPFLILLVLEGIPLLYLEFAIGQRLRRGS
LGVWSSIHPALKGLGLASMLTSFMVGLYYNTIISWIMWYLFNSFQEPLPWSDCPLNENQT
GYVDECARSSPVDYFWYRETLNISTSISDSGSIQWWMLLCLACAWSVLYMCTIRGIETTG
KAVYITSTLPYVVLTIFLIRGLTLKGATNGIVFLFTPNVTELAQPDTWLDAGAQVFFSFS
LAFGGLISFSSYNSVHNNCEKDSVIVSIINGFTSVYVAIVVYSVIGFRATQRYDDCFSTN
ILTLINGFDLPEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGTGLAF
IVFTEAITKMPLSPLWSVLFFIMLFCLGLSSMFGNMEGVVVPLQDLRVIPPKWPKEVLTG
LICLGTFLIGFIFTLNSGQYWLSLLDSYAGSIPLLIIAFCEMFSVVYVYGVDRFNKDIEF
MIGHKPNIFWQVTWRVVSPLLMLIIFLFFFVVEVSQELTYSIWDPGYEEFPKSQKISYPN
WVYVVVVIVAGVPSLTIPGYAIYKLIRNHCQKPGDHQGLVSTLSTASMNGDLKY

Sequence of entity 2 (B, D), FASTA

>7DWX_2 Angiotensin-converting enzyme 2 (chains B, D)
MASGRSSSSWLLLSLVAVTAAWSHPQFEKQSTIEEQAKTFLDKFNHEAEDLFYQSSLASW
NYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVL
SEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESW
RSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEH
TFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQK
PNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTA
WDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIM
SLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEI
PKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEA
LCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYF
EPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVA
YAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSR
SRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDR
KKKNKARSGENPYASIDISKGENNPGFQNTDDVQTSF

Sequence of entity 3 (E, F, G, H, I, J), FASTA

>7DWX_3 Spike glycoprotein (chains E, F, G, H, I, J)
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS
NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV
NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE
GKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN
CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD
YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC
NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVN
FNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP
GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSY
ECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI
SVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQE
VFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDC
LGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM
QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN
TLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRA
SANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPA
ICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDP
LQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL
QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDD
SEPVLKGVKLHYTLEDYKDDDDK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
LEU	Leucine	C6 H13 N O2	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	64

Primary citation

Structural basis for the different states of the spike protein of SARS-CoV-2 in complex with ACE2. Yan, R., Zhang, Y., Li, Y. et al. Cell Res (2021) 31:717-719. DOI 10.1038/s41422-021-00490-0 · PubMed

Other PDB entries of the same protein (UniProt Q695T7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9KXW 2.66 Å, Structure of human B0AT1-ACE2
9KY0 2.68 Å, Structure of human B0AT1-ACE2 complex with compound3
9KXT 2.7 Å, Structure of human B0AT1-ACE2 complex with compound1
9KXV 2.71 Å, Structure of human B0AT1-ACE2 complex with compound3
9KXX 2.77 Å, Inward-open Structure of human B0AT1
9KXZ 2.8 Å, Structure of human B0AT1-ACE2 complex with compound1
9KY1 2.8 Å, Structure of human B0AT1-ACE2 complex with compound1
9KXY 2.82 Å, Structure of human B0AT1-ACE2 complex with compound1
9KXU 2.87 Å, Structure of human B0AT1-ACE2 complex with compound 2
9VA2 2.87 Å, Structure of the ACE2-B0AT1 bound with Phenylalanine
6M17 2.9 Å, The 2019-nCoV RBD/ACE2-B0AT1 complex
6M18 2.9 Å, ACE2-B0AT1 complex

Browse structure collections

About this viewer

MolViewer shows 7DWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.