7V61: PDB entry 7V61

ACE2 -Targeting Monoclonal Antibody as Potent and Broad-Spectrum Coronavirus Blocker. Determined by electron microscopy at 3.2 Å resolution. Released 22 Jun 2022.

Method: Electron microscopy
Resolution: 3.2 Å
Organisms: Homo sapiens, Severe acute respiratory syndrome coronavirus 2
Chains: 8
Atoms: 29,076
Mol. weight: 489.75 kDa
Ligands: NAG, ZN
Released: 22 Jun 2022

Explore 7V61 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7V61 contains 174 α-helices and 114 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 32 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
α-helix	39-49	11
α-helix	58-64	7
α-helix	71-77	7
α-helix	78-82	5
α-helix	83-96	14
α-helix	101-104	4
α-helix	113-141	29
α-helix	153-154	2
β-strand	155	1	1
β-strand	162	1	1
α-helix	164-168	5
α-helix	171-177	7
α-helix	195-211	17
α-helix	219-241	23
α-helix	251-254	4
α-helix	259-262	4
α-helix	267-278	12
α-helix	286-290	5
α-helix	300-348	49
α-helix	361-370	10
α-helix	397-400	4
α-helix	403-408	6
α-helix	413-440	28
α-helix	442-445	4
α-helix	455-469	15
α-helix	472-474	3
α-helix	478-503	26
α-helix	504-510	7
α-helix	511-522	12
α-helix	528-532	5
α-helix	533-537	5
α-helix	538-552	15
α-helix	582-607	26

Chains B and D: 45 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	20-52	33
α-helix	59-78	20
α-helix	79-82	4
α-helix	91-101	11
α-helix	104-107	4
α-helix	110-129	20
β-strand	131-133	3	2
β-strand	141-143	3	2
α-helix	144-148	5
α-helix	149-154	6
α-helix	158-192	35
α-helix	199-203	5
α-helix	204-206	3
β-strand	209	1	3
β-strand	217	1	3
α-helix	221-230	10
α-helix	234-248	15
β-strand	262-263	2	4
α-helix	276-278	3
α-helix	279-282	4
α-helix	289-290	2
α-helix	296-299	4
α-helix	306-316	11
β-strand	332	1	5
β-strand	347-350	4	5
β-strand	356-359	4	5
α-helix	366-382	17
α-helix	385-387	3
α-helix	390-392	3
α-helix	401-412	12
α-helix	415-418	4
α-helix	429-431	3
α-helix	434-443	10
α-helix	447-449	3
α-helix	450-464	15
α-helix	473-480	8
α-helix	481-485	5
β-strand	487-488	2	4
α-helix	499-502	4
α-helix	504-507	4
α-helix	514-532	19
α-helix	539-541	3
α-helix	548-558	11
α-helix	566-571	6
α-helix	582-587	6
α-helix	589-598	10
α-helix	603-604	2
β-strand	618-622	5	6
α-helix	624-627	4
α-helix	637-657	21
α-helix	667-669	3
β-strand	670-676	7	6
β-strand	680-685	6	6
β-strand	686-687	2	7
β-strand	690-694	5	7
α-helix	695-696	2
α-helix	697-706	10
α-helix	708-714	7
β-strand	722-723	2	6
α-helix	742-767	26

Chains H and I: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	8
β-strand	11-12	2	9
β-strand	20-25	6	8
β-strand	34-39	6	10
β-strand	45-51	7	10
α-helix	54-56	3
β-strand	58-60	3	10
β-strand	68-73	6	8
β-strand	78-83	6	8
β-strand	93-99	7	10
β-strand	108-111	4	10
β-strand	115-116	2	10
β-strand	118-119	2	9
β-strand	128-132	5	11
β-strand	140	1	11
β-strand	143-153	11	11
β-strand	158-162	5	12
α-helix	163-165	3
β-strand	172-173	2	11
α-helix	174-176	3
β-strand	177-178	2	11
β-strand	184-193	10	11
α-helix	194-196	3
β-strand	203-208	6	12
β-strand	213-218	6	12

Chains K and M: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	13
β-strand	10-11	2	14
α-helix	13-14	2
β-strand	19-24	6	13
β-strand	35-38	4	15
β-strand	45-48	4	15
β-strand	56	1	16
β-strand	58	1	16
β-strand	62-65	4	13
β-strand	70-75	6	13
β-strand	85-88	4	15
β-strand	103-104	2	14
α-helix	112-113	2
β-strand	114-118	5	17
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-137	9	17
β-strand	145-150	6	18
β-strand	153-154	2	18
β-strand	159-163	5	17
α-helix	164-167	4
β-strand	175-182	8	17
α-helix	183-186	4
β-strand	191-197	7	18
β-strand	205-210	6	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium-dependent neutral amino acid transporter B(0)AT1	A, C	protein	654	Homo sapiens	Q695T7 (AlphaFold model)
Angiotensin-converting enzyme 2	B, D	protein	817	Homo sapiens	Q9BYF1 (AlphaFold model)
3E8	H, I	protein	451	Severe acute respiratory syndrome coronavirus 2
3E8	K, M	protein	214	Severe acute respiratory syndrome coronavirus 2

Sequence of entity 1 (A, C), FASTA

>7V61_1 Sodium-dependent neutral amino acid transporter B(0)AT1 (chains A, C)
MADYKDDDDKSGPDEVDASGRVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNKAQ
YMLTCLGFCVGLGNVWRFPYLCQSHGGGAFMIPFLILLVLEGIPLLYLEFAIGQRLRRGS
LGVWSSIHPALKGLGLASMLTSFMVGLYYNTIISWIMWYLFNSFQEPLPWSDCPLNENQT
GYVDECARSSPVDYFWYRETLNISTSISDSGSIQWWMLLCLACAWSVLYMCTIRGIETTG
KAVYITSTLPYVVLTIFLIRGLTLKGATNGIVFLFTPNVTELAQPDTWLDAGAQVFFSFS
LAFGGLISFSSYNSVHNNCEKDSVIVSIINGFTSVYVAIVVYSVIGFRATQRYDDCFSTN
ILTLINGFDLPEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGTGLAF
IVFTEAITKMPLSPLWSVLFFIMLFCLGLSSMFGNMEGVVVPLQDLRVIPPKWPKEVLTG
LICLGTFLIGFIFTLNSGQYWLSLLDSYAGSIPLLIIAFCEMFSVVYVYGVDRFNKDIEF
MIGHKPNIFWQVTWRVVSPLLMLIIFLFFFVVEVSQELTYSIWDPGYEEFPKSQKISYPN
WVYVVVVIVAGVPSLTIPGYAIYKLIRNHCQKPGDHQGLVSTLSTASMNGDLKY

Sequence of entity 2 (B, D), FASTA

>7V61_2 Angiotensin-converting enzyme 2 (chains B, D)
MASGRSSSSWLLLSLVAVTAAWSHPQFEKQSTIEEQAKTFLDKFNHEAEDLFYQSSLASW
NYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVL
SEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESW
RSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEH
TFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQK
PNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTA
WDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIM
SLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEI
PKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEA
LCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYF
EPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVA
YAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSR
SRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDR
KKKNKARSGENPYASIDISKGENNPGFQNTDDVQTSF

Sequence of entity 3 (H, I), FASTA

>7V61_3 3E8 (chains H, I)
EVQLEESGAELVRPGASVKISCKAFGYTFTNHHINWMKQRPGQGLDWIGYVNPYNDYTKY
SQNFKGKATLSVDRSSSTAYMELSSLTSEDSAVYYCARWRDYDRDWYFDVWGAGTTVIVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Sequence of entity 4 (K, M), FASTA

>7V61_4 3E8 (chains K, M)
DIVMTQSPATLSVTPGDRVSLSCRASQSIRDYLYWYQQKSHESPRLLIKYASQSISGIPS
RFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPYTFGGGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	10
ZN	Zinc ion	Zn	2

Primary citation

ACE2-targeting monoclonal antibody as potent and broad-spectrum coronavirus blocker. Chen, Y., Zhang, Y.N., Yan, R. et al. Signal Transduct Target Ther (2021) 6:315-315. DOI 10.1038/s41392-021-00740-y · PubMed

Other PDB entries of the same protein (UniProt Q695T7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9KXW 2.66 Å, Structure of human B0AT1-ACE2
9KY0 2.68 Å, Structure of human B0AT1-ACE2 complex with compound3
9KXT 2.7 Å, Structure of human B0AT1-ACE2 complex with compound1
9KXV 2.71 Å, Structure of human B0AT1-ACE2 complex with compound3
9KXX 2.77 Å, Inward-open Structure of human B0AT1
9KXZ 2.8 Å, Structure of human B0AT1-ACE2 complex with compound1
9KY1 2.8 Å, Structure of human B0AT1-ACE2 complex with compound1
9KXY 2.82 Å, Structure of human B0AT1-ACE2 complex with compound1
9KXU 2.87 Å, Structure of human B0AT1-ACE2 complex with compound 2
9VA2 2.87 Å, Structure of the ACE2-B0AT1 bound with Phenylalanine
6M17 2.9 Å, The 2019-nCoV RBD/ACE2-B0AT1 complex
6M18 2.9 Å, ACE2-B0AT1 complex

Browse structure collections

About this viewer

MolViewer shows 7V61 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.