8Q7N: Human spliceosomal B complex protomer

cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region). Determined by electron microscopy at 3.1 Å resolution. Released 24 Jan 2024.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 21
Atoms: 55,463
Mol. weight: 1427.48 kDa
Released: 24 Jan 2024

Explore 8Q7N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8Q7N contains 325 α-helices and 198 β-strands across 17 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 7: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	412	1	1
α-helix	422-431	10
α-helix	436-449	14
α-helix	452-454	3
α-helix	459-471	13

Chain A: 108 helices, 76 β-strands

Element	Residues	Length	Sheet
α-helix	63-73	11
α-helix	79-81	3
α-helix	85-90	6
α-helix	91-93	3
α-helix	95-104	10
α-helix	106-108	3
β-strand	115-121	7	35
β-strand	127-129	3	35
β-strand	134-135	2	36
α-helix	137-157	21
α-helix	163-165	3
α-helix	173-177	5
α-helix	178-182	5
α-helix	189-191	3
α-helix	201-204	4
β-strand	220	1	37
β-strand	227-229	3	37
α-helix	232-241	10
α-helix	252-255	4
α-helix	260-268	9
α-helix	276-278	3
β-strand	294	1	38
α-helix	299-301	3
α-helix	310-315	6
α-helix	317-320	4
α-helix	329-331	3
α-helix	334-337	4
α-helix	357-359	3
β-strand	379	1	3
α-helix	398-405	8
β-strand	415-417	3	37
β-strand	419-420	2	36
α-helix	421-423	3
α-helix	428-431	4
α-helix	434-435	2
α-helix	441-460	20
α-helix	463-466	4
α-helix	472-477	6
β-strand	482-488	7	35
α-helix	489-510	22
β-strand	516-518	3	39
β-strand	524-526	3	39
α-helix	529-531	3
α-helix	532-537	6
α-helix	542-565	24
α-helix	571-583	13
α-helix	585-588	4
α-helix	591-593	3
α-helix	596-598	3
α-helix	599-616	18
α-helix	631-659	29
α-helix	681-695	15
α-helix	706-721	16
α-helix	733-762	30
α-helix	769-797	29
α-helix	804-820	17
α-helix	822-824	3
β-strand	825	1	40
α-helix	826-829	4
α-helix	835-847	13
α-helix	858-872	15
α-helix	874-887	14
α-helix	892-893	2
β-strand	894-900	7	41
β-strand	905-910	6	41
α-helix	913-932	20
α-helix	948-960	13
β-strand	973-980	8	42
β-strand	981	1	43
α-helix	990-997	8
β-strand	1001	1	40
α-helix	1003-1013	11
β-strand	1016-1019	4	41
β-strand	1022-1025	4	41
α-helix	1037-1062	26
α-helix	1077-1080	4
β-strand	1085-1091	7	42
β-strand	1094-1101	8	42
α-helix	1103-1116	14
β-strand	1142	1	38
α-helix	1145-1159	15
β-strand	1168	1	43
β-strand	1174-1178	5	42
β-strand	1185-1188	4	44
β-strand	1192	1	45
β-strand	1193-1198	6	44
β-strand	1213-1217	5	44
β-strand	1224-1229	6	44
β-strand	1232	1	45
α-helix	1234-1249	16
α-helix	1256-1274	19
α-helix	1277-1280	4
α-helix	1282-1303	22
α-helix	1314-1317	4
α-helix	1320-1322	3
β-strand	1334-1335	2	46
β-strand	1341-1346	6	47
β-strand	1349-1354	6	47
α-helix	1360-1362	3
β-strand	1363-1364	2	46
α-helix	1365-1367	3
α-helix	1369-1371	3
α-helix	1375-1398	24
β-strand	1403	1	33
α-helix	1419-1423	5
α-helix	1436-1442	7
α-helix	1443-1445	3
α-helix	1468-1477	10
α-helix	1480-1485	6
α-helix	1490-1493	4
β-strand	1501-1504	4	23
α-helix	1508-1512	5
α-helix	1513-1515	3
α-helix	1520-1524	5
α-helix	1529-1537	9
α-helix	1539-1542	4
β-strand	1553-1554	2	48
β-strand	1561-1562	2	48
α-helix	1567-1576	10
α-helix	1581-1599	19
β-strand	1606-1611	6	49
β-strand	1629-1639	11	49
α-helix	1640-1642	3
β-strand	1643-1644	2	49
β-strand	1655-1667	13	49
α-helix	1676-1688	13
β-strand	1700-1706	7	49
β-strand	1711-1716	6	49
α-helix	1722-1735	14
α-helix	1738-1751	14
β-strand	1753-1755	3	23
α-helix	1759-1761	3
β-strand	1762-1763	2	50
α-helix	1769-1772	4
β-strand	1777-1778	2	51
β-strand	1779-1781	3	52
β-strand	1787-1792	6	53
β-strand	1798-1803	6	53
β-strand	1805-1810	6	52
β-strand	1818-1822	5	52
α-helix	1824-1827	4
α-helix	1834-1849	16
β-strand	1860-1862	3	51
α-helix	1866-1868	3
α-helix	1869-1875	7
β-strand	1883-1885	3	51
β-strand	1886-1887	2	50
α-helix	1895-1898	4
α-helix	1900-1906	7
β-strand	1914-1916	3	52
α-helix	1923-1925	3
α-helix	1929-1945	17
α-helix	1949-1953	5
α-helix	1973-1995	23
α-helix	1999-2001	3
α-helix	2004-2012	9
β-strand	2040-2041	2	18
β-strand	2042-2046	5	20
β-strand	2054-2058	5	20
α-helix	2073-2080	8
α-helix	2084-2086	3
β-strand	2091-2092	2	54
β-strand	2104-2107	4	55
α-helix	2108-2116	9
β-strand	2124-2129	6	54
β-strand	2140-2141	2	55
β-strand	2144-2146	3	54
β-strand	2150	1	56
β-strand	2151-2152	2	57
β-strand	2157-2158	2	57
α-helix	2163-2164	2
β-strand	2176-2180	5	54
α-helix	2190-2202	13
β-strand	2212-2218	7	54
β-strand	2223-2230	8	54
α-helix	2232-2240	9
α-helix	2253-2255	3
β-strand	2256-2259	4	54
β-strand	2261-2264	4	55
β-strand	2270-2274	5	54
β-strand	2280	1	56
β-strand	2296-2298	3	54
α-helix	2300-2303	4
α-helix	2311-2315	5

Chain C: 39 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	116-124	9
α-helix	126-128	3
β-strand	129-136	8	2
α-helix	142-153	12
α-helix	172-177	6
β-strand	184-191	8	2
β-strand	197-204	8	2
α-helix	209-211	3
α-helix	212-219	8
β-strand	224-230	7	2
α-helix	237-248	12
β-strand	252-258	7	2
α-helix	262-266	5
α-helix	271-291	21
β-strand	307-311	5	2
β-strand	316-318	3	2
α-helix	320-331	12
α-helix	336-340	5
β-strand	348-350	3	3
β-strand	355-357	3	3
α-helix	368-369	2
α-helix	370-374	5
α-helix	375-386	12
α-helix	392-398	7
α-helix	405-408	4
α-helix	412-424	13
α-helix	428-436	9
α-helix	441-452	12
β-strand	453	1	4
β-strand	475-483	9	5
β-strand	490-498	9	5
β-strand	501-502	2	6
β-strand	506-510	5	5
β-strand	522-526	5	5
β-strand	530-533	4	5
β-strand	534	1	2
β-strand	538-541	4	5
β-strand	543-544	2	6
β-strand	549-553	5	5
β-strand	563-566	4	5
β-strand	577	1	4
α-helix	578-582	5
β-strand	588-594	7	7
α-helix	597-599	3
α-helix	600-613	14
β-strand	618-621	4	7
β-strand	627-631	5	7
α-helix	634-642	9
α-helix	643-649	7
β-strand	653-655	3	7
α-helix	656-658	3
β-strand	659-660	2	7
β-strand	663-666	4	8
β-strand	674-677	4	9
β-strand	684-690	7	9
α-helix	691-693	3
α-helix	696-701	6
α-helix	711-720	10
α-helix	726-730	5
β-strand	732-736	5	9
β-strand	743-747	5	9
α-helix	756-760	5
α-helix	763-776	14
β-strand	784	1	8
β-strand	787-795	9	9
α-helix	805-821	17
β-strand	825-838	14	8
α-helix	840-842	3
α-helix	843-852	10
β-strand	856-862	7	8
α-helix	863	1
β-strand	869-876	8	8
α-helix	877-879	3
α-helix	883-890	8
β-strand	896-906	11	8
α-helix	907	1
α-helix	926-941	16

Chain D: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	10
α-helix	11-19	9
β-strand	25-31	7	10
α-helix	36-49	14
β-strand	56-61	6	10
α-helix	69-73	5
β-strand	79-84	6	10
β-strand	89	1	10
β-strand	91-93	3	11
β-strand	102	1	10
α-helix	109-124	16
β-strand	129-131	3	11

Chain F: 6 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	82-96	15
α-helix	105-114	10
α-helix	126-139	14
α-helix	144-151	8
β-strand	168-169	2	25
α-helix	172-201	30
α-helix	204-219	16
β-strand	221-228	8	26
β-strand	234-239	6	27
β-strand	245-250	6	27
β-strand	255-259	5	27
β-strand	265-269	5	27
β-strand	276-281	6	28
β-strand	296-300	5	28
β-strand	305-308	4	28
β-strand	317-319	3	28
β-strand	326-331	6	29
β-strand	337-342	6	29
β-strand	347-351	5	29
β-strand	357-361	5	29
β-strand	368-373	6	30
β-strand	379-384	6	30
β-strand	389-393	5	30
β-strand	398-402	5	30
β-strand	410-415	6	31
β-strand	421-426	6	31
β-strand	431-435	5	31
β-strand	440-445	6	31
β-strand	452-457	6	32
β-strand	464-469	6	32
β-strand	473-478	6	32
β-strand	484-489	6	32
β-strand	495-500	6	26
β-strand	506-511	6	26
β-strand	515-521	7	26

Chain I: 14 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
α-helix	12-14	3
α-helix	17-20	4
α-helix	23-30	8
α-helix	33-37	5
α-helix	44-52	9
β-strand	57	1	12
β-strand	60-61	2	13
β-strand	66-67	2	13
α-helix	69-80	12
α-helix	84-92	9
α-helix	97-110	14
α-helix	113-120	8
α-helix	121-125	5
β-strand	129-133	5	12
β-strand	139-143	5	12
α-helix	144-153	10
β-strand	156-157	2	14
β-strand	160-161	2	14
α-helix	162-167	6
α-helix	168-173	6

Chain J: 13 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	389-394	6
β-strand	417-418	2	25
β-strand	437	1	1
α-helix	442-465	24
α-helix	470-474	5
α-helix	481-484	4
α-helix	486-491	6
α-helix	493-518	26
α-helix	519-521	3
α-helix	522-534	13
β-strand	541-548	8	58
α-helix	554-566	13
β-strand	570-575	6	58
β-strand	580-586	7	58
α-helix	588-596	9
α-helix	597-601	5
β-strand	630-638	9	58
β-strand	647-650	4	58
α-helix	654-664	11
α-helix	667-682	16

Chain K: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	272-313	42
α-helix	334-336	3
α-helix	339-341	3
α-helix	354-357	4

9 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
U5 snRNA	5	RNA	117	Homo sapiens
U6 snRNA	6	RNA	106	Homo sapiens
Splicing factor 3A subunit 1	7	protein	793	Homo sapiens	Q15459 (AlphaFold model)
116 kDa U5 small nuclear ribonucleoprotein component	C	protein	972	Homo sapiens	Q15029 (AlphaFold model)
Thioredoxin-like protein 4A	D	protein	142	Homo sapiens	P83876 (AlphaFold model)
Pre-mRNA-splicing factor 38A	I	protein	312	Homo sapiens	Q8NAV1 (AlphaFold model)
Microfibrillar-associated protein 1	K	protein	439	Homo sapiens	P55081
NHP2-like protein 1, N-terminally processed	M	protein	128	Homo sapiens	P55769
Protein BUD31 homolog	Q	protein	144	Homo sapiens	P41223
WW domain-binding protein 4	X	protein	376	Homo sapiens	O75554
MINX pre-mRNA	Z	RNA	347	Homo sapiens
Zinc finger matrin-type protein 2	r	protein	199	Homo sapiens	Q96NC0

9 more molecules are not listed.

Sequence of entity 1 (5), FASTA

>8Q7N_1 U5 snRNA (chains 5)
AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGG
AGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA

Sequence of entity 2 (6), FASTA

>8Q7N_2 U6 snRNA (chains 6)
GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGC
CCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUU

Sequence of entity 3 (7), FASTA

>8Q7N_3 Splicing factor 3A subunit 1 (chains 7)
MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFV
ARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQ
QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQ
FLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVL
DQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTT
PEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSD
DEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKI
PASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVE
ETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDD
TKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRP
PMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAP
VPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEW
KLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAV
IHLALKERGGRKK

Sequence of entity 4 (C), FASTA

>8Q7N_4 116 kDa U5 small nuclear ribonucleoprotein component (chains C)
MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLH
EDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLA
DLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVG
IKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLIL
SPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKA
PTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVC
KKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIE
VNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSEL
PKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVV
TFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLC
DELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPA
DCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSV
FHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM

Sequence of entity 5 (D), FASTA

>8Q7N_5 Thioredoxin-like protein 4A (chains D)
MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL
VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVY
RGARKGRGLVVSPKDYSTKYRY

Sequence of entity 6 (I), FASTA

>8Q7N_6 Pre-mRNA-splicing factor 38A (chains I)
MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGV
YGGNIKPTPFLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYL
EPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEPR
VSALEEDMDDVESSEEEEEEDEKLERVPSPDHRRRSYRDLDKPRRSPTLRYRRSRSRSPR
RRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSKSPGHHRSHRHRSHSKSPERS
KKSHKKSRRGNE

Sequence of entity 7 (K), FASTA

>8Q7N_7 Microfibrillar-associated protein 1 (chains K)
MSVPSALMKQPPIQSTAGAVPVRNEKGEISMEKVKVKRYVSGKRPDYAPMESSDEEDEEF
QFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLARHRKIVEPEVVGESDSEV
EGDAWRMEREDSSEEEEEEIDDEEIERRRGMMRQRAQERKNEEMEVMEVEDEGRSGEESE
SESEYEEYTDSEDEMEPRLKPVFIRKKDRVTVQEREAEALKQKELEQEAKRMAEERRKYT
LKIVEEETKKELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKE
KAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDF
SAPTLEDHFNKTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSAWGQESAQNTKFFKQK
AAGVRDVFERPSAKKRKTT

Sequence of entity 8 (M), FASTA

>8Q7N_8 NHP2-like protein 1, N-terminally processed (chains M)
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADA
EPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQ
QSIERLLV

Sequence of entity 9 (Q), FASTA

>8Q7N_9 Protein BUD31 homolog (chains Q)
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYI
FDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR
VPKSKLEVGRIIECTHCGCRGCSG

Sequence of entity 10 (X), FASTA

>8Q7N_10 WW domain-binding protein 4 (chains X)
MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEK
ASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRK
KDPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTY
YYNTETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQEAEEGGV
STETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEI
KQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMADGVAPVFKKRR
TENGKSRNLRQRGDDQ

Sequence of entity 11 (Z), FASTA

>8Q7N_11 MINX pre-mRNA (chains Z)
GGUACCUAAUACGACUCACUAUAGGGAGACGGAAUUCGAGCUCGCCCACUCUUGGAUCGG
AAACCCGUCGGCCUCCGAACGGUAAGAGCCUAGCAUGUAGAACUGGUUACCUGCAGCCCA
AGCUUGCUGCACGUCUAGGGCGCAGUAGUCCAGGGUUUCCUUGAUGAUGUCAUACUUAUC
CUGUCCCUUUUUUUUCCACAGCUCGCGGUUGAGGACAAACUCUUCGCGGUCUUUCCAGUG
GGGAUCCAAUAUCCGUACACCAUCAGGGUACGAGCUAGCCCAUGGCGUACACCAUCAGGG
UACGACUAGUAGAUCUCGUACACCAUCAGGGUACGGAAUUCUCUAGA

Sequence of entity 12 (r), FASTA

>8Q7N_12 Zinc finger matrin-type protein 2 (chains r)
MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLES
KLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLD
QVKKRFEVNKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEED
DEMAAVMGFSGFGSTKKSY

Primary citation

Cryo-EM analyses of dimerized spliceosomes provide new insights into the functions of B complex proteins. Zhang, Z., Kumar, V., Dybkov, O. et al. EMBO J (2024) 43:1065-1088. DOI 10.1038/s44318-024-00052-1 · PubMed

Other PDB entries of the same protein (UniProt Q15459 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7P0V 1.56 Å, Crystal structure of human SF3A1 ubiquitin-like domain in complex with U1 snRNA…
8ID2 1.8 Å, Crystal structure of the ubiquitin-like domain in the SF3A1 subunit of human U2 snRNP…
7EVO 2.5 Å, The cryo-EM structure of the human 17S U2 snRNP
8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
8HK1 2.7 Å, The cryo-EM structure of human pre-17S U2 snRNP
7VPX 3.0 Å, The cryo-EM structure of the human pre-A complex
8I0R 3.0 Å, The cryo-EM structure of human Bact-I complex
8I0T 3.0 Å, The cryo-EM structure of human Bact-III complex
8QOZ 3.1 Å, Cryo-EM Structure of Pre-B+5'ss+ATPgammaS Complex (core part)
8QPE 3.1 Å, Cryo-EM Structure of Pre-B-like Complex (core part)
8H6E 3.2 Å, Cryo-EM structure of human exon-defined spliceosome in the late pre-B state.

Browse structure collections

About this viewer

MolViewer shows 8Q7N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.