9LSZ: Inward-open Structure of human B0AT1

Inward-open Structure of human B0AT1. Determined by electron microscopy at 3.11 Å resolution. Released 18 Feb 2026.

Method: Electron microscopy
Resolution: 3.11 Å
Organisms: Homo sapiens, Mus musculus
Chains: 3
Atoms: 6,458
Mol. weight: 130.67 kDa
Released: 18 Feb 2026

Explore 9LSZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9LSZ contains 48 α-helices and 36 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 42 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	18-25	8
α-helix	40-47	8
α-helix	52	1
α-helix	53-57	5
α-helix	58-63	6
α-helix	68-77	10
α-helix	78-82	5
α-helix	83-96	14
α-helix	100-107	8
α-helix	109-111	3
α-helix	113-141	29
α-helix	153-154	2
β-strand	155	1	1
α-helix	156	1
β-strand	162	1	1
α-helix	164-168	5
α-helix	171-174	4
α-helix	175-180	6
β-strand	193	1	2
α-helix	195-211	17
α-helix	216-226	11
α-helix	229-242	14
α-helix	247-255	9
α-helix	259-262	4
α-helix	265-279	15
α-helix	285-290	6
α-helix	299-347	49
α-helix	360-370	11
α-helix	372-376	5
α-helix	385-390	6
α-helix	398-408	11
α-helix	413-446	34
α-helix	455-474	20
β-strand	475	1	2
α-helix	478-489	12
α-helix	492-503	12
α-helix	504-508	5
α-helix	511-522	12
α-helix	525-527	3
α-helix	528-532	5
α-helix	533-537	5
α-helix	538-553	16
β-strand	559-562	4	3
β-strand	574-577	4	3
α-helix	578-579	2
α-helix	582-586	5
α-helix	587-591	5
α-helix	592-607	16

Chain H: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	8
β-strand	14	1	9
α-helix	15-17	3
β-strand	18-19	2	10
β-strand	26-29	4	11
β-strand	30	1	9
β-strand	33	1	8
α-helix	37-39	3
β-strand	41-47	7	10
β-strand	53-59	7	10
β-strand	66-68	3	10
α-helix	70-72	3
β-strand	76-81	6	11
α-helix	82-84	3
β-strand	86-91	6	11
β-strand	100-107	8	10
β-strand	109	1	12
β-strand	114	1	12
β-strand	119	1	10
β-strand	125-128	4	10

Chain L: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	13-14	2	4
β-strand	19-20	2	5
β-strand	28-34	7	4
β-strand	39-40	2	6
β-strand	45-46	2	6
β-strand	48-53	6	5
β-strand	63	1	7
β-strand	64	1	5
β-strand	69	1	7
α-helix	70	1
β-strand	77-81	5	4
β-strand	85-90	6	4
α-helix	95-97	3
β-strand	100-105	6	5
β-strand	111	1	5
β-strand	116-118	3	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium-dependent neutral amino acid transporter B(0)AT1	A	protein	614	Homo sapiens	Q695T7 (AlphaFold model)
Antibody Fab Light chain	L	protein	225	Mus musculus
Antibody Fab Heavy chain	H	protein	335	Mus musculus

Sequence of entity 1 (A), FASTA

>9LSZ_1 Sodium-dependent neutral amino acid transporter B(0)AT1 (chains A)
MNPGLDARIPSLAELETIEQEEASSRPKWDNKAQYMLTCLGFCVGLGNVWRFPYLCQSHG
GGAFMIPFLILLVLLGIPLLYLEFAIGQRLRRGSLGVWSSIHPALKGIGLASMLTSFMVG
LYYNTIISWIMWYLFNSFQEPLPWSDCPLNENQTGYVDECARSSPVDYFWYRETLNISTS
ISDSGSIQWWMLLCLACAWSVLYMCTIRGIETTGKAVYITSTLPYVVLTIFLIRGLTLKG
ATNGIVFLFTPNVTELAQPDTWLDAGAQVFFSFSLAFGGLISFASYNSVHNNCEKDSVIV
SIINGFTSVYVAIVVYSVIGFRATQRYDDCFSTNILTLINGFDLPEGNVTQENFVDMQQR
CNASDPAAYAQLVFQTCDINAFLSEAVEGTGLAFIVFTEAITKMPLSPLWSVLFFIMLFC
LGLSSMFGNMEGVVVPLQDLRVIPPKWPKEVLTGLICLGTFLIGLIFTLNSGQYWLSLLD
SYAGSIPLLIIAFAEMFSVVWVYGVDRFNKDIEFMIGHKPNIFWQVTWRVVSPLLLLIIF
LFFFVVEVSQELTYSIWDPGYEEFPKSQKISYPNWVYVVVVIVAGVPSLTIPGYAIYKLI
RNHAQKPGDHQGLV

Sequence of entity 2 (L), FASTA

>9LSZ_2 Antibody Fab Light chain (chains L)
AQAAELDIVMTQSPSSLVVSAGEKVTMTCKSSQSLFNSRTRKNYLAWYQQKPGQSPKLLI
YWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSSYLLTFGAGTKLELKRA
DAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSK
DSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 3 (H), FASTA

>9LSZ_3 Antibody Fab Heavy chain (chains H)
GGSSRSSLEVQLQQSGPELVKPGASVKISCKASGYTFTDYYINWVKQRPGQGLEWIGWIY
PRSGGTKYIEKFKGKATLTVDTSSSTAYMQLNSLTSEDSAVYFCARFYYSYNEDYYALDY
WSQGTSVTVSSAKTTAPSVYPLAPVCGDTSGSSVTLGCLVKGYFPEPVTLTWNSGSLSSG
VHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPP
CKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHT
AQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKC

Primary citation

Structure-guided development of a potent human B 0 AT1 inhibitor effective in a mouse model of phenylketonuria. Imazu, T., Akashi, T., Hiraizumi, M. et al. Commun Biol (2026). DOI 10.1038/s42003-026-10535-y · PubMed

Other PDB entries of the same protein (UniProt Q695T7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9KXW 2.66 Å, Structure of human B0AT1-ACE2
9KY0 2.68 Å, Structure of human B0AT1-ACE2 complex with compound3
9KXT 2.7 Å, Structure of human B0AT1-ACE2 complex with compound1
9KXV 2.71 Å, Structure of human B0AT1-ACE2 complex with compound3
9KXX 2.77 Å, Inward-open Structure of human B0AT1
9KXZ 2.8 Å, Structure of human B0AT1-ACE2 complex with compound1
9KY1 2.8 Å, Structure of human B0AT1-ACE2 complex with compound1
9KXY 2.82 Å, Structure of human B0AT1-ACE2 complex with compound1
9KXU 2.87 Å, Structure of human B0AT1-ACE2 complex with compound 2
9VA2 2.87 Å, Structure of the ACE2-B0AT1 bound with Phenylalanine
6M17 2.9 Å, The 2019-nCoV RBD/ACE2-B0AT1 complex
6M18 2.9 Å, ACE2-B0AT1 complex

Browse structure collections

About this viewer

MolViewer shows 9LSZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.