1LAR: Tandem phosphatase domains of rptp lar

Crystal structure of the tandem phosphatase domains of rptp lar. Determined by X-ray diffraction at 2.0 Å resolution. Released 25 Apr 2000.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 9,338
Mol. weight: 132.18 kDa
Released: 25 Apr 2000

Explore 1LAR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LAR contains 42 α-helices and 52 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	1308-1318	11
α-helix	1324-1332	9
α-helix	1342-1345	4
α-helix	1350-1352	3
β-strand	1365	1	1
α-helix	1367-1370	4
β-strand	1382-1387	6	1
β-strand	1390-1397	8	1
α-helix	1398-1401	4
α-helix	1405-1414	10
β-strand	1419-1422	4	1
β-strand	1427-1428	2	2
β-strand	1431-1432	2	2
β-strand	1443-1446	4	1
β-strand	1449-1458	10	1
β-strand	1462-1471	10	1
β-strand	1477-1485	9	1
α-helix	1498-1510	13
β-strand	1518-1521	4	1
α-helix	1528-1545	18
α-helix	1550-1558	9
α-helix	1568-1584	17
β-strand	1589-1590	2	3
α-helix	1591-1593	3
α-helix	1594-1601	8
α-helix	1612-1618	7
α-helix	1636-1641	6
β-strand	1654	1	4
β-strand	1660	1	5
β-strand	1663	1	5
β-strand	1671-1674	4	4
β-strand	1683-1686	4	4
α-helix	1691-1693	3
α-helix	1694-1703	10
β-strand	1708-1711	4	4
β-strand	1716-1717	2	6
β-strand	1720-1721	2	6
β-strand	1733-1735	3	4
β-strand	1738-1747	10	4
β-strand	1751-1760	10	4
β-strand	1765-1774	10	4
α-helix	1787-1802	16
α-helix	1808	1
β-strand	1809-1812	4	4
α-helix	1819-1836	18
β-strand	1838-1839	2	3
α-helix	1841-1848	8
α-helix	1859-1874	16

Chain B: 20 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	1342-1345	4
α-helix	1350-1352	3
β-strand	1365	1	7
α-helix	1368-1371	4
β-strand	1382-1387	6	7
β-strand	1390-1397	8	7
α-helix	1398-1401	4
α-helix	1405-1414	10
β-strand	1419-1422	4	7
β-strand	1427	1	8
β-strand	1432	1	8
β-strand	1443-1446	4	7
β-strand	1449-1458	10	7
β-strand	1462-1471	10	7
β-strand	1477-1485	9	7
α-helix	1498-1510	13
β-strand	1518-1521	4	7
α-helix	1528-1545	18
α-helix	1550-1560	11
α-helix	1568-1584	17
β-strand	1589-1590	2	9
α-helix	1594-1601	8
α-helix	1612-1618	7
α-helix	1631-1634	4
α-helix	1636-1641	6
β-strand	1654	1	10
β-strand	1660	1	11
β-strand	1663	1	11
β-strand	1671-1674	4	10
β-strand	1683-1686	4	10
α-helix	1691-1693	3
α-helix	1694-1703	10
β-strand	1708-1711	4	10
β-strand	1716-1717	2	12
β-strand	1720-1721	2	12
β-strand	1733-1735	3	10
β-strand	1738-1747	10	10
β-strand	1751-1760	10	10
β-strand	1766-1774	9	10
α-helix	1787-1802	16
α-helix	1808	1
β-strand	1809-1812	4	10
α-helix	1819-1836	18
β-strand	1838-1839	2	9
α-helix	1841-1849	9
α-helix	1859-1875	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (LAR)	A, B	protein	575	Homo sapiens	P10586 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1LAR_1 PROTEIN (LAR) (chains A, B)
MITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRV
ILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRL
EEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQFM
AWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEK
TVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNLYAHIQKLGQVPP
GESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGS
DYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQY
WPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTG
EGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVK
TLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT

Primary citation

Crystal structure of the tandem phosphatase domains of RPTP LAR. Nam, H.J., Poy, F., Krueger, N.X. et al. Cell (1999) 97:449-457. DOI 10.1016/S0092-8674(00)80755-2 · PubMed

Other PDB entries of the same protein (UniProt P10586 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N5U 1.46 Å, Crystal structure of the 4th FN3 domain of human Protein Tyrosine phosphatase, receptor…
6TPU 1.55 Å, Crystal structures of FNIII domain three and four of the human leucocyte common…
6TPV 1.8 Å, Crystal structures of FNIII domain one and two of the human leucocyte common…
2YD8 2.05 Å, Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine…
2YD5 2.2 Å, Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine…
6KR4 2.85 Å, Crystal structure of the liprin-alpha3_SAM123/LAR_D1D2 complex
6TPW 2.9 Å, Crystal structures of FNIII domain one through four of the human leucocyte common…
6TPT 3.2 Å, Crystal structures of FNIII domain three and four of the human leucocyte common…
2DJU Solution structures of the fn3 domain of human receptor-type tyrosine-protein…
2DN7 Solution structures of the 6th fn3 domain of human receptor-type tyrosine-protein…
2EDX Solution structures of the fn3 domain of human receptor-type tyrosine-protein…
2EDY Solution structures of the fn3 domain of human receptor-type tyrosine-protein…

Browse structure collections

About this viewer

MolViewer shows 1LAR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.