6TPV: Receptor-type tyrosine-protein phosphatase F

Crystal structures of FNIII domain one and two of the human leucocyte common antigen-related protein, LAR. Determined by X-ray diffraction at 1.8 Å resolution. Released 13 May 2020.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,325
Mol. weight: 45.53 kDa
Released: 13 May 2020

Explore 6TPV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TPV contains 18 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	319-322	4
β-strand	323-330	8	1
β-strand	335-340	6	1
α-helix	346-347	2
β-strand	349-356	8	2
α-helix	362-363	2
β-strand	364-369	6	2
β-strand	373-376	4	1
α-helix	379-380	2
β-strand	384-392	9	2
β-strand	397	1	2
α-helix	399-403	5
β-strand	404-407	4	2
α-helix	416-417	2
β-strand	418-424	7	3
β-strand	430-435	6	3
β-strand	444-452	9	4
α-helix	459-461	3
β-strand	463-467	5	4
β-strand	472-475	4	3
α-helix	478-479	2
β-strand	483-492	10	4
β-strand	496	1	4
α-helix	498-502	5
β-strand	503-506	4	4

Chain B: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	318-322	5
β-strand	323-330	8	5
β-strand	335-340	6	5
α-helix	346-347	2
β-strand	349-356	8	6
α-helix	362-363	2
β-strand	364-369	6	6
β-strand	373-376	4	5
α-helix	379-380	2
β-strand	384-392	9	6
β-strand	397-400	4	6
α-helix	401-403	3
β-strand	404-407	4	6
β-strand	418-424	7	7
β-strand	430-435	6	7
β-strand	446-452	7	8
α-helix	459-461	3
β-strand	463-467	5	8
β-strand	472-475	4	7
α-helix	478-479	2
β-strand	483-491	9	8
β-strand	496	1	8
α-helix	498-502	5
β-strand	503-506	4	8
α-helix	507-508	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-type tyrosine-protein phosphatase F	A, B	protein	208	Homo sapiens	P10586 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6TPV_1 Receptor-type tyrosine-protein phosphatase F (chains A, B)
MHHHHHHENLYFQGPKPPIDLVVTETTATSVTLTWDSGNSEPVTYYGIQYRAAGTEGPFQ
EVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARM
LSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPPNAWHKHNTDAGLLTTVGSLLPGITY
SLRVLAFTAVGDGPPSPTIQVKTQQGVP

Primary citation

Crystal and solution structures of fragments of the human leucocyte common antigen-related protein. Vilstrup, J., Simonsen, A., Birkefeldt, T. et al. Acta Crystallogr D Struct Biol (2020) 76:406-417. DOI 10.1107/S2059798320003885 · PubMed

Other PDB entries of the same protein (UniProt P10586 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N5U 1.46 Å, Crystal structure of the 4th FN3 domain of human Protein Tyrosine phosphatase, receptor…
6TPU 1.55 Å, Crystal structures of FNIII domain three and four of the human leucocyte common…
1LAR 2.0 Å, Crystal structure of the tandem phosphatase domains of rptp lar
2YD8 2.05 Å, Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine…
2YD5 2.2 Å, Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine…
6KR4 2.85 Å, Crystal structure of the liprin-alpha3_SAM123/LAR_D1D2 complex
6TPW 2.9 Å, Crystal structures of FNIII domain one through four of the human leucocyte common…
6TPT 3.2 Å, Crystal structures of FNIII domain three and four of the human leucocyte common…
2DJU Solution structures of the fn3 domain of human receptor-type tyrosine-protein…
2DN7 Solution structures of the 6th fn3 domain of human receptor-type tyrosine-protein…
2EDX Solution structures of the fn3 domain of human receptor-type tyrosine-protein…
2EDY Solution structures of the fn3 domain of human receptor-type tyrosine-protein…

Browse structure collections

About this viewer

MolViewer shows 6TPV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.