Solution structures of the fn3 domain of human receptor-type tyrosine-protein phosphatase F. Determined by solution NMR. Released 21 Aug 2007.
Explore 2EDX in 3D Show helices and sheets RCSB PDB PDBe
2EDX contains 4 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23-28 | 6 | 1 |
| β-strand | 34-40 | 7 | 1 |
| α-helix | 41-43 | 3 | |
| β-strand | 51-60 | 10 | 2 |
| α-helix | 67-68 | 2 | |
| β-strand | 69-71 | 3 | 2 |
| β-strand | 75 | 1 | 2 |
| β-strand | 80-84 | 5 | 1 |
| β-strand | 91-100 | 10 | 2 |
| β-strand | 103 | 1 | 2 |
| β-strand | 111-114 | 4 | 2 |
| α-helix | 115-117 | 3 | |
| α-helix | 121-124 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein tyrosine phosphatase, receptor type, F | A | protein | 134 | Homo sapiens | P10586 (AlphaFold model) |
>2EDX_1 Protein tyrosine phosphatase, receptor type, F (chains A) GSSGSSGTIEARTAQSTPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEA VDGEDRGRHVVDGISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVP SGPPRKVESGPSSG
Solution structures of the fn3 domain of human receptor-type tyrosine-protein phosphatase F. Sato, M., Koshiba, S., Inoue, M. et al. To be published.
Other PDB entries of the same protein (UniProt P10586 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2EDX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.