Crystal structure of the 4th FN3 domain of human Protein Tyrosine phosphatase, receptor type F [PSI-NYSGRC-006240]. Determined by X-ray diffraction at 1.46 Å resolution. Released 30 Oct 2013.
Explore 4N5U in 3D Show helices and sheets RCSB PDB PDBe
4N5U contains 4 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 611-619 | 9 | 1 |
| β-strand | 622-628 | 7 | 1 |
| α-helix | 629-631 | 3 | |
| α-helix | 632-634 | 3 | |
| β-strand | 639-648 | 10 | 2 |
| β-strand | 657-663 | 7 | 2 |
| β-strand | 668-671 | 4 | 1 |
| α-helix | 674-675 | 2 | |
| β-strand | 679-688 | 10 | 2 |
| β-strand | 692-695 | 4 | 2 |
| α-helix | 696-698 | 3 | |
| β-strand | 699-702 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Receptor-type tyrosine-protein phosphatase F | A | protein | 117 | Homo sapiens | P10586 (AlphaFold model) |
>4N5U_1 Receptor-type tyrosine-protein phosphatase F (chains A) QDYGGTAQSTPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRG RHVVDGISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEAENLYFQ
Crystal structure of the 4th FN3 domain of human PTP, receptor F [PSI-NYSGRC-006240]. Kumar, P.R., Casadevall, A., Almo, S.C. To be published.
Other PDB entries of the same protein (UniProt P10586 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4N5U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.