6TPU: Receptor-type tyrosine-protein phosphatase F

Crystal structures of FNIII domain three and four of the human leucocyte common antigen-related protein, LAR. Determined by X-ray diffraction at 1.55 Å resolution. Released 13 May 2020.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,616
Mol. weight: 43.83 kDa
Released: 13 May 2020

Explore 6TPU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TPU contains 19 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	513-515	3
β-strand	519-522	4	1
β-strand	528-531	4	1
α-helix	533-535	3
β-strand	540-549	10	2
α-helix	550-552	3
β-strand	556-561	6	2
β-strand	566-569	4	1
α-helix	572-573	2
β-strand	577-586	10	2
β-strand	589-590	2	2
α-helix	592-596	5
β-strand	597-600	4	2
α-helix	601-603	3
β-strand	611-617	7	3
β-strand	623-628	6	3
α-helix	629-631	3
α-helix	632-634	3
β-strand	641-648	8	4
β-strand	656-663	8	4
β-strand	668-671	4	3
α-helix	674-675	2
β-strand	679-688	10	4
β-strand	691-695	5	4
α-helix	696-698	3
β-strand	699-702	4	4

Chain B: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	519-522	4	5
β-strand	528-531	4	5
α-helix	533-535	3
β-strand	540-549	10	6
α-helix	550-552	3
β-strand	557-561	5	6
β-strand	566-569	4	5
α-helix	572-573	2
β-strand	577-586	10	6
β-strand	591-593	3	6
α-helix	594-596	3
β-strand	597-600	4	6
α-helix	601-603	3
β-strand	611-617	7	7
β-strand	622-628	7	7
α-helix	629-631	3
α-helix	632-634	3
β-strand	639-648	10	8
β-strand	656-663	8	8
β-strand	668-672	5	7
α-helix	674-675	2
β-strand	679-688	10	8
β-strand	691-695	5	8
α-helix	696-698	3
β-strand	699-702	4	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-type tyrosine-protein phosphatase F	A, B	protein	195	Homo sapiens	P10586 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6TPU_1 Receptor-type tyrosine-protein phosphatase F (chains A, B)
GAQPADFQAEVESDTRIQLSWLLPPQERIIMYELVYWAAEDEDQQHKVTFDPTSSYTLED
LKPDTLYRFQLAARSDMGVGVFTPTIEARTAQSTPSAPPQKVMCVSMGSTTVRVSWVPPP
ADSRNGVITQYSVAYEAVDGEDRGRHVVDGISREHSSWDLVGLEKWTEYRVWVRAHTDVG
PGPESSPVLVRTDED

Primary citation

Crystal and solution structures of fragments of the human leucocyte common antigen-related protein. Vilstrup, J., Simonsen, A., Birkefeldt, T. et al. Acta Crystallogr D Struct Biol (2020) 76:406-417. DOI 10.1107/S2059798320003885 · PubMed

Other PDB entries of the same protein (UniProt P10586 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N5U 1.46 Å, Crystal structure of the 4th FN3 domain of human Protein Tyrosine phosphatase, receptor…
6TPV 1.8 Å, Crystal structures of FNIII domain one and two of the human leucocyte common…
1LAR 2.0 Å, Crystal structure of the tandem phosphatase domains of rptp lar
2YD8 2.05 Å, Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine…
2YD5 2.2 Å, Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine…
6KR4 2.85 Å, Crystal structure of the liprin-alpha3_SAM123/LAR_D1D2 complex
6TPW 2.9 Å, Crystal structures of FNIII domain one through four of the human leucocyte common…
6TPT 3.2 Å, Crystal structures of FNIII domain three and four of the human leucocyte common…
2DJU Solution structures of the fn3 domain of human receptor-type tyrosine-protein…
2DN7 Solution structures of the 6th fn3 domain of human receptor-type tyrosine-protein…
2EDX Solution structures of the fn3 domain of human receptor-type tyrosine-protein…
2EDY Solution structures of the fn3 domain of human receptor-type tyrosine-protein…

Browse structure collections

About this viewer

MolViewer shows 6TPU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.