Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine Phosphatase LAR. Determined by X-ray diffraction at 2.2 Å resolution. Released 13 Apr 2011.
Explore 2YD5 in 3D Show helices and sheets RCSB PDB PDBe
2YD5 contains 9 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 31-37 | 7 | 1 |
| α-helix | 39-41 | 3 | |
| β-strand | 42-45 | 4 | 2 |
| β-strand | 50-59 | 10 | 1 |
| α-helix | 61-62 | 2 | |
| β-strand | 63-68 | 6 | 2 |
| β-strand | 71-72 | 2 | 2 |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-93 | 6 | 1 |
| α-helix | 98-101 | 4 | |
| β-strand | 103-111 | 9 | 2 |
| β-strand | 114-125 | 12 | 2 |
| α-helix | 127-129 | 3 | |
| β-strand | 136-139 | 4 | 3 |
| β-strand | 144-147 | 4 | 4 |
| β-strand | 152-154 | 3 | 5 |
| β-strand | 157-159 | 3 | 3 |
| α-helix | 163-164 | 2 | |
| β-strand | 165-170 | 6 | 4 |
| β-strand | 173-174 | 2 | 4 |
| α-helix | 177-179 | 3 | |
| β-strand | 184-186 | 3 | 5 |
| β-strand | 192-194 | 3 | 5 |
| α-helix | 199-201 | 3 | |
| β-strand | 203-210 | 8 | 4 |
| β-strand | 215-217 | 3 | 4 |
| α-helix | 218-220 | 3 | |
| β-strand | 221-226 | 6 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Receptor-type tyrosine-protein phosphatase F | A | protein | 214 | HOMO SAPIENS | P10586 (AlphaFold model) |
>2YD5_1 RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE F (chains A) ETGDSKPVFIKVPEDQTGLSGGVASFVCQATGEPKPRITWMKKGKKVSSQRFEVIEFDDG AGSVLRIQPLRVQRDEAIYECTATNSLGEINTSAKLSVLEEEQLPPGFPSIDMGPQLKVV EKARTATMLCAAGGNPDPEISWFKDFLPVDPATSNGRIKQLRSGALQIESSEESDQGKYE CVATNSAGTRYSAPANLYVRVRRVAGTKHHHHHH
Proteoglycan-Specific Molecular Switch for Rptp Sigma Clustering and Neuronal Extension. Coles, C.H., Shen, Y., Tenney, A.P. et al. Science (2011) 332:484. DOI 10.1126/SCIENCE.1200840 · PubMed
Other PDB entries of the same protein (UniProt P10586 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2YD5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.