Crystal structures of FNIII domain one through four of the human leucocyte common antigen-related protein ( LAR). Determined by X-ray diffraction at 2.9 Å resolution. Released 13 May 2020.
Explore 6TPW in 3D Show helices and sheets RCSB PDB PDBe
6TPW contains 15 α-helices and 33 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 320-322 | 3 | |
| β-strand | 326-330 | 5 | 1 |
| β-strand | 335-338 | 4 | 1 |
| β-strand | 349-355 | 7 | 2 |
| α-helix | 363 | 1 | |
| β-strand | 364-369 | 6 | 2 |
| β-strand | 373-376 | 4 | 1 |
| α-helix | 379-380 | 2 | |
| β-strand | 384-392 | 9 | 2 |
| β-strand | 397-400 | 4 | 2 |
| β-strand | 404-407 | 4 | 2 |
| β-strand | 418-424 | 7 | 3 |
| β-strand | 430-435 | 6 | 3 |
| β-strand | 444-452 | 9 | 4 |
| α-helix | 459-461 | 3 | |
| β-strand | 463-467 | 5 | 4 |
| β-strand | 472-475 | 4 | 3 |
| α-helix | 478-479 | 2 | |
| β-strand | 485-492 | 8 | 4 |
| β-strand | 496 | 1 | 4 |
| α-helix | 498-502 | 5 | |
| β-strand | 503-504 | 2 | 4 |
| β-strand | 506 | 1 | 3 |
| α-helix | 511-515 | 5 | |
| β-strand | 516-522 | 7 | 5 |
| β-strand | 528-533 | 6 | 5 |
| α-helix | 534-535 | 2 | |
| β-strand | 542-549 | 8 | 6 |
| β-strand | 556-561 | 6 | 6 |
| β-strand | 566-569 | 4 | 5 |
| α-helix | 572-573 | 2 | |
| β-strand | 577-586 | 10 | 6 |
| β-strand | 589-590 | 2 | 6 |
| α-helix | 592-596 | 5 | |
| β-strand | 597-600 | 4 | 6 |
| α-helix | 601-603 | 3 | |
| β-strand | 611-616 | 6 | 7 |
| β-strand | 622-628 | 7 | 7 |
| α-helix | 629-631 | 3 | |
| α-helix | 632-634 | 3 | |
| β-strand | 641-648 | 8 | 8 |
| β-strand | 659-663 | 5 | 8 |
| β-strand | 668-672 | 5 | 7 |
| α-helix | 674-675 | 2 | |
| β-strand | 679-687 | 9 | 8 |
| β-strand | 692-695 | 4 | 8 |
| α-helix | 696-698 | 3 | |
| β-strand | 699-702 | 4 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Receptor-type tyrosine-protein phosphatase F | A | protein | 402 | Homo sapiens | P10586 (AlphaFold model) |
>6TPW_1 Receptor-type tyrosine-protein phosphatase F (chains A) MHHHHHHENLYFQGPKPPIDLVVTETTATSVTLTWDSGNSEPVTYYGIQYRAAGTEGPFQ EVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARM LSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPPNAWHKHNTDAGLLTTVGSLLPGITY SLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERIIMYE LVYWAAEDEDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEARTAQS TPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRGRHVVDGISR EHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDED
Crystal and solution structures of fragments of the human leucocyte common antigen-related protein. Vilstrup, J., Simonsen, A., Birkefeldt, T. et al. Acta Crystallogr D Struct Biol (2020) 76:406-417. DOI 10.1107/S2059798320003885 · PubMed
Other PDB entries of the same protein (UniProt P10586 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6TPW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.