2DN7: Receptor-type tyrosine-protein phosphatase F

Solution structures of the 6th fn3 domain of human receptor-type tyrosine-protein phosphatase F. Determined by solution NMR. Released 25 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 819
Mol. weight: 11.68 kDa
Released: 25 Oct 2006

Explore 2DN7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DN7 contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	12-17	6	1
β-strand	22-28	7	1
β-strand	39-46	8	2
β-strand	53-58	6	2
β-strand	63-67	5	1
α-helix	69-70	2
β-strand	74-83	10	2
β-strand	86-96	11	2
α-helix	97-100	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-type tyrosine-protein phosphatase F	A	protein	107	Homo sapiens	P10586 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DN7_1 Receptor-type tyrosine-protein phosphatase F (chains A)
GSSGSSGPGRPTMMISTTAMNTALLQWHPPKELPGELLGYRLQYCRADEARPNTIDFGKD
DQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRTPEDLSGPSSG

Primary citation

Solution structures of the 6th fn3 domain of human receptor-type tyrosine-protein phosphatase F. Sato, M., Tochio, N., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt P10586 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N5U 1.46 Å, Crystal structure of the 4th FN3 domain of human Protein Tyrosine phosphatase, receptor…
6TPU 1.55 Å, Crystal structures of FNIII domain three and four of the human leucocyte common…
6TPV 1.8 Å, Crystal structures of FNIII domain one and two of the human leucocyte common…
1LAR 2.0 Å, Crystal structure of the tandem phosphatase domains of rptp lar
2YD8 2.05 Å, Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine…
2YD5 2.2 Å, Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine…
6KR4 2.85 Å, Crystal structure of the liprin-alpha3_SAM123/LAR_D1D2 complex
6TPW 2.9 Å, Crystal structures of FNIII domain one through four of the human leucocyte common…
6TPT 3.2 Å, Crystal structures of FNIII domain three and four of the human leucocyte common…
2DJU Solution structures of the fn3 domain of human receptor-type tyrosine-protein…
2EDX Solution structures of the fn3 domain of human receptor-type tyrosine-protein…
2EDY Solution structures of the fn3 domain of human receptor-type tyrosine-protein…

Browse structure collections

About this viewer

MolViewer shows 2DN7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.