2AAV: Filamin A domain 17

Solution NMR structure of Filamin A domain 17. Determined by solution NMR. Released 2 May 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 706
Mol. weight: 10.08 kDa
Released: 2 May 2006

Explore 2AAV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AAV contains 1 α-helix and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	1869-1871	3	1
α-helix	1873-1875	3
β-strand	1877-1879	3	2
β-strand	1884-1886	3	3
β-strand	1887-1889	3	1
β-strand	1899-1903	5	2
β-strand	1911-1912	2	3
β-strand	1919	1	1
β-strand	1922-1924	3	3
β-strand	1930-1938	9	2
β-strand	1941-1942	2	2
β-strand	1948-1953	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin A	A	protein	98	Homo sapiens	P21333 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2AAV_1 Filamin A (chains A)
GAMVVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDG
TCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD

Primary citation

The structure of the GPIb-filamin A complex. Nakamura, F., Pudas, R., Heikkinen, O. et al. Blood (2006) 107:1925-1932. DOI 10.1182/blood-2005-10-3964 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex

Browse structure collections

About this viewer

MolViewer shows 2AAV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.