2BRQ: Filamin A repeat 21

Crystal structure of the filamin A repeat 21 complexed with the integrin beta7 cytoplasmic tail peptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 7 Feb 2006.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 1,666
Mol. weight: 27.83 kDa
Ligands: GSH
Released: 7 Feb 2006

Explore 2BRQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BRQ contains 9 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	1
α-helix	2246-2248	3
β-strand	2251-2252	2	2
β-strand	2257-2262	6	1
β-strand	2269-2277	9	2
β-strand	2281-2286	6	1
β-strand	2293-2299	7	1
β-strand	2303-2311	9	2
β-strand	2314-2315	2	2
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	2
α-helix	2327-2328	2

Chain B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	3
α-helix	2246-2248	3
β-strand	2251-2252	2	2
β-strand	2257-2262	6	3
β-strand	2269-2277	9	2
β-strand	2281-2287	7	3
β-strand	2293-2299	7	3
β-strand	2303-2311	9	2
β-strand	2314-2315	2	2
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	2

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	777-786	10	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin a	A, B	protein	97	HOMO SAPIENS	P21333 (AlphaFold model)
Integrin beta-7 subunit	C, D	protein	31	HOMO SAPIENS	P26010 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2BRQ_1 FILAMIN A (chains A, B)
GAMGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGS
CGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS

Sequence of entity 2 (C, D), FASTA

>2BRQ_2 INTEGRIN BETA-7 SUBUNIT (chains C, D)
LNWKQDSNPLYKSAITTTINPRFQEADSPTL

Ligands and cofactors

ID	Name	Formula	Copies
GSH	Glutathione	C10 H17 N3 O6 S	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

The Molecular Basis of Filamin Binding to Integrins and Competition with Talin. Kiema, T., Lad, Y., Jiang, P. et al. Mol Cell (2006) 21:337. DOI 10.1016/J.MOLCEL.2006.01.011 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex
3RGH 2.44 Å, Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

Browse structure collections

About this viewer

MolViewer shows 2BRQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.