2DK7: Transcription elongation regulator 1

Name: PDB 2DK7: Solution structure of WW domain in transcription elongation regulator 1
Published: 2007-04-24
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Solution structure of WW domain in transcription elongation regulator 1. Determined by solution NMR. Released 24 Apr 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 553
Mol. weight: 7.86 kDa
Released: 24 Apr 2007

Explore 2DK7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DK7 contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	11-16	6	1
α-helix	17	1
β-strand	23-27	5	1
β-strand	32-36	5	1
β-strand	41-42	2	1
α-helix	55-61	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription elongation regulator 1	A	protein	73	Homo sapiens	O14776 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DK7_1 Transcription elongation regulator 1 (chains A)
GSSGSSGKAKPVATAPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKII
QEPPHKKSGPSSG

Primary citation

Solution structure of WW domain in transcription elongation regulator 1. He, F., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt O14776 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q1I 1.4 Å, Polo-like kinase I Polo-box domain in complex with FMPPPMSpSM phosphopeptide from TCERG1
4FQG 2.0 Å, Crystal structure of the TCERG1 FF4-6 tandem repeat domain
3HFH 2.7 Å, Crystal structure of tandem FF domains
8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
9R3D 3.12 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
7ABF 3.9 Å, Human pre-Bact-1 spliceosome core structure
8QO9 5.29 Å, Cryo-EM structure of a human spliceosomal B complex protomer
7ABG 7.8 Å, Human pre-Bact-1 spliceosome
9R8V 8.5 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
2DOD Solution structure of the first FF domain of human transcription factor CA150
2DOE Solution structure of the third FF domain of human transcription factor CA150
2DOF Solution structure of the fourth FF domain of human transcription factor CA150

Browse structure collections

About this viewer

MolViewer shows 2DK7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.