2DOE: Transcription elongation regulator 1

Name: PDB 2DOE: Solution structure of the third FF domain of human transcription factor CA150
Published: 2006-10-28
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Solution structure of the third FF domain of human transcription factor CA150. Determined by solution NMR. Released 28 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 651
Mol. weight: 9.29 kDa
Released: 28 Oct 2006

Explore 2DOE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DOE contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	792-805	14
α-helix	814-821	8
α-helix	826-829	4
α-helix	833-848	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription elongation regulator 1	A	protein	83	Homo sapiens	O14776 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DOE_1 Transcription elongation regulator 1 (chains A)
GSSGSSGEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMR
EDLFKQYIEKIAKNLDSSGPSSG

Primary citation

Solution structure of the third FF domain of human transcription factor CA150. Suzuki, S., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt O14776 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q1I 1.4 Å, Polo-like kinase I Polo-box domain in complex with FMPPPMSpSM phosphopeptide from TCERG1
4FQG 2.0 Å, Crystal structure of the TCERG1 FF4-6 tandem repeat domain
3HFH 2.7 Å, Crystal structure of tandem FF domains
8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
9R3D 3.12 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
7ABF 3.9 Å, Human pre-Bact-1 spliceosome core structure
8QO9 5.29 Å, Cryo-EM structure of a human spliceosomal B complex protomer
7ABG 7.8 Å, Human pre-Bact-1 spliceosome
9R8V 8.5 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
2DK7 Solution structure of WW domain in transcription elongation regulator 1
2DOD Solution structure of the first FF domain of human transcription factor CA150
2DOF Solution structure of the fourth FF domain of human transcription factor CA150

Browse structure collections

About this viewer

MolViewer shows 2DOE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.