4FQG: TCERG1 FF4-6 tandem repeat domain

Name: PDB 4FQG: Crystal structure of the TCERG1 FF4-6 tandem repeat domain
Published: 2013-02-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of the TCERG1 FF4-6 tandem repeat domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 27 Feb 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,698
Mol. weight: 46.33 kDa
Ligands: NI
Released: 27 Feb 2013

Explore 4FQG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FQG contains 22 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	2-19	18
α-helix	27-34	8
α-helix	38-43	6
α-helix	48-75	28
α-helix	86-93	8
α-helix	97-100	4
α-helix	106-134	29
α-helix	142-148	7
α-helix	151-160	10
α-helix	164-167	4
α-helix	173-185	13

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	3-19	17
α-helix	27-34	8
α-helix	38-43	6
α-helix	48-75	28
α-helix	86-93	8
α-helix	97-100	4
α-helix	106-134	29
α-helix	142-148	7
α-helix	151-160	10
α-helix	164-167	4
α-helix	173-187	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription elongation regulator 1	A, B	protein	190	Homo sapiens	O14776 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4FQG_1 Transcription elongation regulator 1 (chains A, B)
SHMKREEAIQNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIE
ALTKKKREHFRQLLDETSAITLTSTWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDK
YITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKILQNDKRYLVLDCVPEERRKLI
VAYVDDLDRR

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Specific Interaction of the Transcription Elongation Regulator TCERG1 with RNA Polymerase II Requires Simultaneous Phosphorylation at Ser2, Ser5, and Ser7 within the Carboxyl-terminal Domain Repeat. Liu, J., Fan, S., Lee, C.J. et al. J Biol Chem (2013) 288:10890-10901. DOI 10.1074/jbc.M113.460238 · PubMed

Other PDB entries of the same protein (UniProt O14776 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q1I 1.4 Å, Polo-like kinase I Polo-box domain in complex with FMPPPMSpSM phosphopeptide from TCERG1
3HFH 2.7 Å, Crystal structure of tandem FF domains
8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
9R3D 3.12 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
7ABF 3.9 Å, Human pre-Bact-1 spliceosome core structure
8QO9 5.29 Å, Cryo-EM structure of a human spliceosomal B complex protomer
7ABG 7.8 Å, Human pre-Bact-1 spliceosome
9R8V 8.5 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
2DK7 Solution structure of WW domain in transcription elongation regulator 1
2DOD Solution structure of the first FF domain of human transcription factor CA150
2DOE Solution structure of the third FF domain of human transcription factor CA150
2DOF Solution structure of the fourth FF domain of human transcription factor CA150

Browse structure collections

About this viewer

MolViewer shows 4FQG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.