3HFH: Tandem FF domains

Crystal structure of tandem FF domains. Determined by X-ray diffraction at 2.7 Å resolution. Released 18 Aug 2009.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,178
Mol. weight: 47.66 kDa
Released: 18 Aug 2009

Explore 3HFH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HFH contains 22 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	661-672	12
α-helix	681-684	4
α-helix	685-687	3
α-helix	692-696	5
α-helix	699-732	34
α-helix	773-780	8
α-helix	787-790	4
α-helix	792-804	13
α-helix	814-821	8
α-helix	825-828	4
α-helix	833-844	12

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	661-672	12
α-helix	681-684	4
α-helix	685-687	3
α-helix	692-696	5
α-helix	699-738	40
α-helix	747-753	7
α-helix	758-761	4
α-helix	766-804	39
α-helix	814-821	8
α-helix	825-828	4
α-helix	833-843	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription elongation regulator 1	A, B	protein	190	Homo sapiens	O14776 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3HFH_1 Transcription elongation regulator 1 (chains A, B)
GPLGSARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAE
EERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNE
FVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSM
REDLFKQYIE

Primary citation

Crystal Structure of the Three Tandem FF Domains of the Transcription Elongation Regulator CA150. Lu, M., Yang, J., Ren, Z. et al. J Mol Biol (2009) 393:397-408. DOI 10.1016/j.jmb.2009.07.086 · PubMed

Other PDB entries of the same protein (UniProt O14776 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q1I 1.4 Å, Polo-like kinase I Polo-box domain in complex with FMPPPMSpSM phosphopeptide from TCERG1
4FQG 2.0 Å, Crystal structure of the TCERG1 FF4-6 tandem repeat domain
8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
9R3D 3.12 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
7ABF 3.9 Å, Human pre-Bact-1 spliceosome core structure
8QO9 5.29 Å, Cryo-EM structure of a human spliceosomal B complex protomer
7ABG 7.8 Å, Human pre-Bact-1 spliceosome
9R8V 8.5 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
2DK7 Solution structure of WW domain in transcription elongation regulator 1
2DOD Solution structure of the first FF domain of human transcription factor CA150
2DOE Solution structure of the third FF domain of human transcription factor CA150
2DOF Solution structure of the fourth FF domain of human transcription factor CA150

Browse structure collections

About this viewer

MolViewer shows 3HFH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.