2J3S: Human filamin A Ig domains 19 to 21

Crystal structure of the human filamin A Ig domains 19 to 21. Determined by X-ray diffraction at 2.5 Å resolution. Released 16 Oct 2007.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,779
Mol. weight: 61.8 kDa
Ligands: DIO
Released: 16 Oct 2007

Explore 2J3S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2J3S contains 14 α-helices and 54 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	2045	1	1
α-helix	2047-2049	3
β-strand	2051-2053	3	2
α-helix	2055-2057	3
β-strand	2059-2061	3	3
β-strand	2066-2071	6	2
β-strand	2076	1	1
β-strand	2080-2085	6	3
β-strand	2091-2096	6	2
β-strand	2101-2107	7	2
β-strand	2112-2120	9	3
β-strand	2123-2124	2	3
α-helix	2125	1
α-helix	2128	1
β-strand	2130-2135	6	3
β-strand	2140-2148	9	4
β-strand	2174-2179	6	5
β-strand	2185-2188	4	5
β-strand	2189	1	6
β-strand	2201	1	6
β-strand	2208-2216	9	5
β-strand	2219-2220	2	5
β-strand	2226-2230	5	5
α-helix	2238-2240	3
β-strand	2242-2244	3	7
α-helix	2246-2248	3
β-strand	2251-2252	2	4
β-strand	2255	1	4
β-strand	2257-2262	6	7
β-strand	2265	1	5
β-strand	2269-2277	9	4
β-strand	2281-2287	7	7
β-strand	2292-2299	8	7
β-strand	2303-2311	9	4
β-strand	2314-2315	2	4
α-helix	2319	1
β-strand	2321-2326	6	4

Chain B: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	2045	1	8
α-helix	2047-2049	3
β-strand	2051-2053	3	9
α-helix	2055-2057	3
β-strand	2059-2061	3	10
β-strand	2066-2071	6	9
β-strand	2076	1	8
β-strand	2080-2085	6	10
β-strand	2091-2096	6	9
β-strand	2101-2107	7	9
β-strand	2112-2120	9	10
β-strand	2123-2124	2	10
α-helix	2125	1
α-helix	2128	1
β-strand	2130-2135	6	10
β-strand	2140-2148	9	11
β-strand	2208-2209	2	12
β-strand	2229-2230	2	12
α-helix	2238-2240	3
β-strand	2242-2244	3	13
α-helix	2246-2248	3
β-strand	2251-2252	2	11
β-strand	2255	1	11
β-strand	2257-2262	6	13
β-strand	2269-2277	9	11
β-strand	2281-2287	7	13
β-strand	2292-2299	8	13
β-strand	2303-2311	9	11
β-strand	2314-2315	2	11
α-helix	2319	1
β-strand	2321-2326	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-a	A, B	protein	288	HOMO SAPIENS	P21333 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2J3S_1 FILAMIN-A (chains A, B)
GAMGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGT
CRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCD
LSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHV
PGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKA
EISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS

Ligands and cofactors

ID	Name	Formula	Copies
DIO	1,4-diethylene dioxide	C4 H8 O2	4

Water and common crystallization additives (GOL, BR) are not listed.

Primary citation

Structure of Three Tandem Filamin Domains Reveals Auto-Inhibition of Ligand-Binding. Lad, Y., Kiema, T.-R., Jiang, P. et al. EMBO J (2007) 26:3993. DOI 10.1038/SJ.EMBOJ.7601827 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex

Browse structure collections

About this viewer

MolViewer shows 2J3S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.