2JWE: Tight junction protein ZO-1

Solution structure of the second PDZ domain from human zonula occludens-1: A dimeric form with 3D domain swapping. Determined by solution NMR. Released 30 Oct 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,284
Mol. weight: 20.06 kDa
Released: 30 Oct 2007

Explore 2JWE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JWE contains 4 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
β-strand	16-27	12	1
α-helix	32-36	5
β-strand	44-48	5	1
β-strand	52	1	1
α-helix	58-67	10
β-strand	71-77	7	1

Chain B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
β-strand	16-27	12	1
α-helix	32-36	5
β-strand	44-48	5	1
β-strand	52	1	1
α-helix	58-67	10
β-strand	71-76	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tight junction protein ZO-1	A, B	protein	88	Homo sapiens	Q07157 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2JWE_1 Tight junction protein ZO-1 (chains A, B)
TKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLTD
AKTLIERSKGKLKMVVQRDELEHHHHHH

Primary citation

Solution structure of the second PDZ domain of Zonula Occludens 1. Ji, P., Yang, G., Zhang, J.H. et al. Proteins (2011) 79:1342-1346. DOI 10.1002/prot.22955 · PubMed

Other PDB entries of the same protein (UniProt Q07157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q2Q 1.45 Å, ZO1 PDZ3 in Complex with a Phage-Derived Peptide
2H2B 1.6 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTYL)
2RCZ 1.7 Å, Structure of the second PDZ domain of ZO-1
9HM2 1.72 Å, A swapped dimeric form of ZO1/TJP1 PDZ2 in complex with the C-terminal peptide from…
4YYX 1.79 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin2 C-terminal…
4OEO 1.9 Å, High resolution crystal structure of the unliganded ZO-1 PDZ1 domain
3TSV 1.99 Å, crystal structure of the third PDZ domain of the human ZO-1 MAGUK protein
2H2C 2.0 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTWV)
4OEP 2.35 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin1 C-terminal…
3CYY 2.4 Å, The crystal structure of ZO-1 PDZ2 in complex with the Cx43 peptide
3TSZ 2.5 Å, crystal structure of PDZ3-SH3-GUK core module from human ZO-1 in complex with 12mer…
3LH5 2.6 Å, Crystal Structure of the SH3-Guanylate kinase core domain of ZO-1

Browse structure collections

About this viewer

MolViewer shows 2JWE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.