2KXR: ZO1 ZU5 domain MC/AA mutation

ZO1 ZU5 domain MC/AA mutation. Determined by solution NMR. Released 30 Mar 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 892
Mol. weight: 12.69 kDa
Released: 30 Mar 2011

Explore 2KXR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KXR contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	1
β-strand	15-18	4	2
β-strand	25-28	4	2
β-strand	39-46	8	1
α-helix	52-54	3
β-strand	63	1	1
β-strand	68-69	2	1
β-strand	76-85	10	2
α-helix	102-104	3
β-strand	111-117	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tight junction protein ZO-1	A	protein	118	Homo sapiens	Q07157 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KXR_1 Tight junction protein ZO-1 (chains A)
TVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKG
ETLLSPLVAAGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF

Primary citation

Cdc42-dependent formation of the ZO-1/MRCKb complex at the leading edge controls cell migration. Huo, L., Wen, W., Wang, R. et al. EMBO J (2011) 30:665-678. DOI 10.1038/emboj.2010.353 · PubMed

Other PDB entries of the same protein (UniProt Q07157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q2Q 1.45 Å, ZO1 PDZ3 in Complex with a Phage-Derived Peptide
2H2B 1.6 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTYL)
2RCZ 1.7 Å, Structure of the second PDZ domain of ZO-1
9HM2 1.72 Å, A swapped dimeric form of ZO1/TJP1 PDZ2 in complex with the C-terminal peptide from…
4YYX 1.79 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin2 C-terminal…
4OEO 1.9 Å, High resolution crystal structure of the unliganded ZO-1 PDZ1 domain
3TSV 1.99 Å, crystal structure of the third PDZ domain of the human ZO-1 MAGUK protein
2H2C 2.0 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTWV)
4OEP 2.35 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin1 C-terminal…
3CYY 2.4 Å, The crystal structure of ZO-1 PDZ2 in complex with the Cx43 peptide
3TSZ 2.5 Å, crystal structure of PDZ3-SH3-GUK core module from human ZO-1 in complex with 12mer…
3LH5 2.6 Å, Crystal Structure of the SH3-Guanylate kinase core domain of ZO-1

Browse structure collections

About this viewer

MolViewer shows 2KXR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.