2WFN: Filamin A actin binding domain

Filamin A actin binding domain. Determined by X-ray diffraction at 3.2 Å resolution. Released 27 Oct 2009.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,696
Mol. weight: 63.18 kDa
Released: 27 Oct 2009

Explore 2WFN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WFN contains 30 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	43-57	15
α-helix	58-60	3
α-helix	75-85	11
α-helix	100-115	16
α-helix	119-121	3
α-helix	126-130	5
α-helix	134-144	11
α-helix	145-151	7
α-helix	168-179	12
α-helix	190-192	3
α-helix	196-205	10
α-helix	213-215	3
α-helix	221-235	15
α-helix	244-247	4
α-helix	254-261	8

Chain B: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	43-57	15
α-helix	58-60	3
α-helix	75-85	11
α-helix	100-115	16
α-helix	119-121	3
α-helix	126-130	5
α-helix	134-144	11
α-helix	145-151	7
α-helix	168-179	12
α-helix	190-192	3
α-helix	196-205	10
α-helix	213-215	3
α-helix	221-235	15
α-helix	244-248	5
α-helix	254-261	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-a	A, B	protein	278	HOMO SAPIENS	P21333 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2WFN_1 FILAMIN-A (chains A, B)
MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPK

Primary citation

Structure of the Human Filamin a Actin-Binding Domain. Ruskamo, S., Ylanne, J. Acta Crystallogr D Biol Crystallogr (2009) 65:1217. DOI 10.1107/S0907444909037330 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex

Browse structure collections

About this viewer

MolViewer shows 2WFN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.