Structure of the actin-binding domain of human filamin A mutant E254K. Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Oct 2009.
Explore 3HOC in 3D Show helices and sheets RCSB PDB PDBe
3HOC contains 30 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 40-43 | 4 | |
| α-helix | 44-57 | 14 | |
| α-helix | 58-60 | 3 | |
| α-helix | 75-85 | 11 | |
| α-helix | 100-116 | 17 | |
| α-helix | 126-130 | 5 | |
| α-helix | 134-144 | 11 | |
| α-helix | 145-151 | 7 | |
| α-helix | 168-179 | 12 | |
| α-helix | 190-192 | 3 | |
| α-helix | 196-205 | 10 | |
| α-helix | 213-215 | 3 | |
| α-helix | 221-236 | 16 | |
| α-helix | 244-247 | 4 | |
| α-helix | 254-261 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 44-57 | 14 | |
| α-helix | 62-64 | 3 | |
| α-helix | 75-85 | 11 | |
| α-helix | 100-116 | 17 | |
| α-helix | 126-130 | 5 | |
| α-helix | 134-144 | 11 | |
| α-helix | 145-151 | 7 | |
| α-helix | 168-179 | 12 | |
| α-helix | 190-192 | 3 | |
| α-helix | 196-205 | 10 | |
| α-helix | 213-215 | 3 | |
| α-helix | 221-236 | 16 | |
| α-helix | 244-247 | 4 | |
| α-helix | 254-261 | 8 | |
| α-helix | 263-266 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Filamin-A | A, B | protein | 272 | Homo sapiens | P21333 (AlphaFold model) |
>3HOC_1 Filamin-A (chains A, B) GAMASSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHL KCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRE SIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQ NKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLG IPQVITPEEIVDPNVDKHSVMTYLSQFPKAKL
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 4 |
Skeletal dysplasias due to filamin A mutations result from a gain-of-function mechanism distinct from allelic neurological disorders. Clark, A.R., Sawyer, G.M., Robertson, S.P. et al. Hum Mol Genet (2009) 18:4791-4800. DOI 10.1093/hmg/ddp442 · PubMed
Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3HOC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.