3ISW: Filamin-A immunoglobulin-like repeat 21

Crystal structure of filamin-A immunoglobulin-like repeat 21 bound to an N-terminal peptide of CFTR. Determined by X-ray diffraction at 2.8 Å resolution. Released 7 Apr 2010.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,518
Mol. weight: 22.36 kDa
Released: 7 Apr 2010

Explore 3ISW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ISW contains 7 α-helices and 23 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	1
α-helix	2246-2248	3
β-strand	2251-2252	2	2
β-strand	2255	1	2
β-strand	2257-2262	6	1
β-strand	2269-2277	9	2
β-strand	2281-2287	7	1
β-strand	2293-2299	7	1
β-strand	2303-2311	9	2
β-strand	2314-2315	2	2
α-helix	2316	1
β-strand	2321-2326	6	2

Chain B: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	2238-2240	3
β-strand	2242-2244	3	3
α-helix	2246-2248	3
β-strand	2251-2252	2	2
β-strand	2255	1	2
β-strand	2257-2262	6	3
β-strand	2264	1	4
β-strand	2266	1	4
β-strand	2271-2277	7	2
β-strand	2281-2288	8	3
β-strand	2292-2299	8	3
β-strand	2303-2311	9	2
β-strand	2314-2315	2	2
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	2

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	11-19	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-A	A, B	protein	99	Homo sapiens	P21333 (AlphaFold model)
Cystic fibrosis transmembrane conductance regulator	C	protein	18		P13569 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3ISW_1 Filamin-A (chains A, B)
GAMPDGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKD
GSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS

Sequence of entity 2 (C), FASTA

>3ISW_2 Cystic fibrosis transmembrane conductance regulator (chains C)
PLEKASVVSKLFFSWTAP

Primary citation

Biochemical basis of the interaction between cystic fibrosis transmembrane conductance regulator and immunoglobulin-like repeats of filamin. Smith, L., Page, R.C., Xu, Z. et al. J Biol Chem (2010) 285:17166-17176. DOI 10.1074/jbc.M109.080911 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex

Browse structure collections

About this viewer

MolViewer shows 3ISW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.