3RAU: HD-PTP Bro1 domain

Crystal structure of the HD-PTP Bro1 domain. Determined by X-ray diffraction at 1.95 Å resolution. Released 14 Sept 2011.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,063
Mol. weight: 82.53 kDa
Released: 14 Sept 2011

Explore 3RAU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RAU contains 39 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	13-16	4
β-strand	17-20	4	1
α-helix	23-29	7
α-helix	30-34	5
α-helix	42-56	15
α-helix	62-81	20
β-strand	94-97	4	1
β-strand	104-107	4	1
α-helix	110-131	22
α-helix	137-160	24
α-helix	167-169	3
α-helix	171-195	25
α-helix	200-221	22
α-helix	224-230	7
α-helix	233-262	30
α-helix	266-286	21
α-helix	292-315	24
α-helix	316-320	5
α-helix	327-329	3
α-helix	331-335	5
α-helix	341-343	3
α-helix	349-352	4

Chain B: 19 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	13-16	4
β-strand	17	1	2
α-helix	23-29	7
α-helix	30-34	5
α-helix	42-56	15
α-helix	62-79	18
β-strand	94-97	4	2
β-strand	104-107	4	2
α-helix	110-131	22
α-helix	137-160	24
α-helix	167-169	3
α-helix	171-195	25
α-helix	200-221	22
α-helix	224-230	7
α-helix	232-262	31
α-helix	266-286	21
α-helix	292-315	24
α-helix	316-320	5
α-helix	327-329	3
α-helix	331-335	5
α-helix	349-352	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 23	A, B	protein	363	Homo sapiens	Q9H3S7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3RAU_1 Tyrosine-protein phosphatase non-receptor type 23 (chains A, B)
GEFEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRV
PRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACIL
YNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNV
NLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWK
KLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDAL
RFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFA
KLV

Primary citation

The Phe105 Loop of Alix Bro1 Domain Plays a Key Role in HIV-1 Release. Sette, P., Mu, R., Dussupt, V. et al. Structure (2011) 19:1485-1495. DOI 10.1016/j.str.2011.07.016 · PubMed

Other PDB entries of the same protein (UniProt Q9H3S7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MK2 1.7 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5MK0 1.76 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5MJZ 1.87 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5MK3 2.0 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro 1…
5CRV 2.0 Å, Crystal structure of the Bro domain of HD-PTP in a complex with the core region of STAM2
5MJY 2.25 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5CRU 2.4 Å, Crystal structure of the Bro domain of HD-PTP
5MK1 2.5 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5LM2 2.54 Å, Crystal Structure of HD-PTP phosphatase
5LM1 2.55 Å, Crystal Structure of HD-PTP phosphatase in complex with UBAP1

Browse structure collections

About this viewer

MolViewer shows 3RAU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.