5LM2: HD-PTP phosphatase

Crystal Structure of HD-PTP phosphatase. Determined by X-ray diffraction at 2.54 Å resolution. Released 30 Nov 2016.

Method: X-ray diffraction
Resolution: 2.54 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,318
Mol. weight: 81.45 kDa
Released: 30 Nov 2016

Explore 5LM2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LM2 contains 25 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	13-40	28
α-helix	52-55	4
α-helix	57-58	2
α-helix	59-69	11
α-helix	74-115	42
α-helix	130-169	40
α-helix	173-179	7
α-helix	187-223	37
α-helix	241-245	5
α-helix	246-249	4
α-helix	250-261	12
α-helix	263-275	13
α-helix	278-343	66

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	5-40	36
α-helix	57-58	2
α-helix	59-67	9
α-helix	75-119	45
α-helix	132-169	38
α-helix	173-178	6
α-helix	187-223	37
α-helix	227-229	3
α-helix	237-245	9
α-helix	246-249	4
α-helix	250-275	26
α-helix	278-342	65

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 23	A, B	protein	352	Homo sapiens	Q9H3S7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5LM2_1 Tyrosine-protein phosphatase non-receptor type 23 (chains A, B)
PMAAHEASSLYSEEKAKLLREMMAKIEDKNEVLDQFMDSMQLDPETVDNLDAYSHIPPQL
MEKCAALSVRPDTVRNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELLEQKFQEAVGQAG
AISITSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAALP
TPALSPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSEMKKL
FEEQLKKYDQLKVYLEQNLAAQDRVLCALTEANVQYAAVRRVLSDLDQKWNSTLQTLVAS
YEAYEDLMKKSQEGRDFYADLESKVAALLERTQSTCQAREAARQQLLDRELK

Primary citation

Structural Basis for Selective Interaction between the ESCRT Regulator HD-PTP and UBAP1. Gahloth, D., Levy, C., Heaven, G. et al. Structure (2016) 24:2115-2126. DOI 10.1016/j.str.2016.10.006 · PubMed

Other PDB entries of the same protein (UniProt Q9H3S7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MK2 1.7 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5MK0 1.76 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5MJZ 1.87 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
3RAU 1.95 Å, Crystal structure of the HD-PTP Bro1 domain
5MK3 2.0 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro 1…
5CRV 2.0 Å, Crystal structure of the Bro domain of HD-PTP in a complex with the core region of STAM2
5MJY 2.25 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5CRU 2.4 Å, Crystal structure of the Bro domain of HD-PTP
5MK1 2.5 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5LM1 2.55 Å, Crystal Structure of HD-PTP phosphatase in complex with UBAP1

Browse structure collections

About this viewer

MolViewer shows 5LM2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.