5CRU: Bro domain of HD-PTP

Crystal structure of the Bro domain of HD-PTP. Determined by X-ray diffraction at 2.4 Å resolution. Released 24 Feb 2016.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 11,411
Mol. weight: 162.88 kDa
Released: 24 Feb 2016

Explore 5CRU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CRU contains 77 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	13-15	3
β-strand	16-20	5	1
α-helix	23-32	10
α-helix	38-41	4
α-helix	42-55	14
α-helix	62-79	18
β-strand	94-97	4	1
β-strand	104-107	4	1
α-helix	110-131	22
α-helix	137-160	24
α-helix	167-169	3
α-helix	171-195	25
α-helix	200-221	22
α-helix	224-230	7
α-helix	232-262	31
α-helix	266-286	21
α-helix	292-315	24
α-helix	316-320	5
α-helix	327-329	3
α-helix	331-335	5
α-helix	349-352	4

Chain B: 19 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	13-16	4
β-strand	17-20	4	2
α-helix	23-32	10
α-helix	38-41	4
α-helix	42-55	14
α-helix	62-79	18
β-strand	94-97	4	2
β-strand	104-107	4	2
α-helix	110-131	22
α-helix	137-160	24
α-helix	167-169	3
α-helix	171-195	25
α-helix	200-221	22
α-helix	224-230	7
α-helix	232-262	31
α-helix	266-286	21
α-helix	292-315	24
α-helix	316-320	5
α-helix	327-329	3
α-helix	332-335	4
α-helix	349-352	4

Chain C: 20 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	13-16	4
β-strand	17-20	4	3
α-helix	23-29	7
α-helix	30-34	5
α-helix	38-41	4
α-helix	42-55	14
α-helix	62-79	18
β-strand	94-97	4	3
β-strand	104-107	4	3
α-helix	110-131	22
α-helix	137-160	24
α-helix	167-169	3
α-helix	171-195	25
α-helix	200-221	22
α-helix	224-230	7
α-helix	232-262	31
α-helix	266-285	20
α-helix	292-314	23
α-helix	315-320	6
α-helix	327-329	3
α-helix	331-335	5
α-helix	349-352	4

Chain D: 19 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	13-16	4
β-strand	17-20	4	4
α-helix	23-33	11
α-helix	38-40	3
α-helix	44-55	12
α-helix	62-79	18
β-strand	94-97	4	4
β-strand	104-107	4	4
α-helix	110-131	22
α-helix	137-159	23
α-helix	167-169	3
α-helix	171-195	25
α-helix	200-221	22
α-helix	224-230	7
α-helix	232-262	31
α-helix	266-286	21
α-helix	292-315	24
α-helix	316-320	5
α-helix	327-329	3
α-helix	331-335	5
α-helix	349-352	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 23	A, B, C, D	protein	361	Homo sapiens	Q9H3S7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5CRU_1 Tyrosine-protein phosphatase non-receptor type 23 (chains A, B, C, D)
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPR
DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYN
LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNL
MLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKL
VQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRF
TMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL
V

Primary citation

Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0. Lee, J., Oh, K.-J., Lee, D. et al. PLoS One (2016) 11:e0149113-e0149113. DOI 10.1371/journal.pone.0149113 · PubMed

Other PDB entries of the same protein (UniProt Q9H3S7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MK2 1.7 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5MK0 1.76 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5MJZ 1.87 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
3RAU 1.95 Å, Crystal structure of the HD-PTP Bro1 domain
5MK3 2.0 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro 1…
5CRV 2.0 Å, Crystal structure of the Bro domain of HD-PTP in a complex with the core region of STAM2
5MJY 2.25 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5MK1 2.5 Å, Crystal structure of the His Domain Protein Tyrosine Phosphatase (HD-PTP/PTPN23) Bro1…
5LM2 2.54 Å, Crystal Structure of HD-PTP phosphatase
5LM1 2.55 Å, Crystal Structure of HD-PTP phosphatase in complex with UBAP1

Browse structure collections

About this viewer

MolViewer shows 5CRU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.