Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens. Determined by X-ray diffraction at 2.44 Å resolution. Released 3 Aug 2011.
Explore 3RGH in 3D Show helices and sheets RCSB PDB PDBe
3RGH contains 9 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 156-158 | 3 | |
| α-helix | 160-162 | 3 | |
| β-strand | 164-166 | 3 | 1 |
| α-helix | 168-170 | 3 | |
| β-strand | 172-174 | 3 | 2 |
| β-strand | 179-184 | 6 | 1 |
| β-strand | 193-198 | 6 | 2 |
| β-strand | 204 | 1 | 2 |
| α-helix | 205 | 1 | |
| β-strand | 206-211 | 6 | 1 |
| β-strand | 216-222 | 7 | 1 |
| β-strand | 227-235 | 9 | 2 |
| β-strand | 238-239 | 2 | 2 |
| α-helix | 240 | 1 | |
| β-strand | 245-250 | 6 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 160-162 | 3 | |
| β-strand | 164-166 | 3 | 1 |
| α-helix | 168-170 | 3 | |
| β-strand | 172-174 | 3 | 3 |
| β-strand | 179-184 | 6 | 1 |
| β-strand | 193-198 | 6 | 3 |
| β-strand | 204 | 1 | 3 |
| α-helix | 205 | 1 | |
| β-strand | 206-211 | 6 | 1 |
| β-strand | 216-222 | 7 | 1 |
| β-strand | 227-235 | 9 | 3 |
| β-strand | 238-239 | 2 | 3 |
| α-helix | 240 | 1 | |
| β-strand | 245-250 | 6 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Filamin-A | A, B | protein | 100 | Homo sapiens | P21333 (AlphaFold model) |
>3RGH_1 Filamin-A (chains A, B) GAMDPFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDH GDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPA
Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens. Page, R.C., Clark, J.G., Misra, S. Acta Crystallogr Sect F Struct Biol Cryst Commun (2011) 67:871-876. DOI 10.1107/S1744309111024249 · PubMed
Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3RGH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.