3RGH: Filamin-A

Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens. Determined by X-ray diffraction at 2.44 Å resolution. Released 3 Aug 2011.

Method: X-ray diffraction
Resolution: 2.44 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,519
Mol. weight: 21 kDa
Released: 3 Aug 2011

Explore 3RGH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RGH contains 9 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	156-158	3
α-helix	160-162	3
β-strand	164-166	3	1
α-helix	168-170	3
β-strand	172-174	3	2
β-strand	179-184	6	1
β-strand	193-198	6	2
β-strand	204	1	2
α-helix	205	1
β-strand	206-211	6	1
β-strand	216-222	7	1
β-strand	227-235	9	2
β-strand	238-239	2	2
α-helix	240	1
β-strand	245-250	6	2

Chain B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	160-162	3
β-strand	164-166	3	1
α-helix	168-170	3
β-strand	172-174	3	3
β-strand	179-184	6	1
β-strand	193-198	6	3
β-strand	204	1	3
α-helix	205	1
β-strand	206-211	6	1
β-strand	216-222	7	1
β-strand	227-235	9	3
β-strand	238-239	2	3
α-helix	240	1
β-strand	245-250	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-A	A, B	protein	100	Homo sapiens	P21333 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3RGH_1 Filamin-A (chains A, B)
GAMDPFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDH
GDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPA

Primary citation

Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens. Page, R.C., Clark, J.G., Misra, S. Acta Crystallogr Sect F Struct Biol Cryst Commun (2011) 67:871-876. DOI 10.1107/S1744309111024249 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex

Browse structure collections

About this viewer

MolViewer shows 3RGH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.