3SHW: Tight junction protein ZO-1

Crystal structure of ZO-1 PDZ3-SH3-Guk supramodule complex with Connexin-45 peptide. Determined by X-ray diffraction at 2.9 Å resolution. Released 28 Sept 2011.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,759
Mol. weight: 54.06 kDa
Released: 28 Sept 2011

Explore 3SHW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SHW contains 15 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	422-428	7	1
β-strand	435-440	6	1
β-strand	444-450	7	1
α-helix	455-458	4
β-strand	465-470	6	1
β-strand	473-474	2	1
α-helix	480-489	10
α-helix	491	1
β-strand	495-502	8	1
α-helix	504-513	10
β-strand	519-523	5	2
β-strand	527	1	3
β-strand	534	1	2
α-helix	535-536	2
β-strand	537	1	3
β-strand	542-547	6	2
α-helix	550-552	3
β-strand	556-562	7	2
β-strand	568-575	8	2
α-helix	577-588	12
β-strand	633-639	7	2
β-strand	647-650	4	4
α-helix	654-664	11
β-strand	669-671	3	4
α-helix	672-673	2
β-strand	675	1	5
β-strand	688	1	5
α-helix	691-698	8
β-strand	703-706	4	4
α-helix	710-718	9
β-strand	724-729	6	4
α-helix	733-743	11
α-helix	751-765	15
α-helix	766-768	3
β-strand	771-774	4	4
β-strand	776	1	6
β-strand	779	1	6
α-helix	781-794	14
β-strand	798-801	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tight junction protein ZO-1	A	protein	468	Homo sapiens	Q07157 (AlphaFold model)
Gap junction gamma-1 protein	B	protein	10		P36383 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3SHW_1 Tight junction protein ZO-1 (chains A)
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRAD
FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK
LAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ
WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND
GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGM

Sequence of entity 2 (B), FASTA

>3SHW_2 Gap junction gamma-1 protein (chains B)
SGDGKTSVWI

Primary citation

The Structure of the PDZ3-SH3-GuK Tandem of ZO-1 Suggests a Supramodular Organization of the Conserved MAGUK Family Scaffold Core. Pan, L., Chen, J., Yu, J. et al. To be published.

Other PDB entries of the same protein (UniProt Q07157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q2Q 1.45 Å, ZO1 PDZ3 in Complex with a Phage-Derived Peptide
2H2B 1.6 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTYL)
2RCZ 1.7 Å, Structure of the second PDZ domain of ZO-1
9HM2 1.72 Å, A swapped dimeric form of ZO1/TJP1 PDZ2 in complex with the C-terminal peptide from…
4YYX 1.79 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin2 C-terminal…
4OEO 1.9 Å, High resolution crystal structure of the unliganded ZO-1 PDZ1 domain
3TSV 1.99 Å, crystal structure of the third PDZ domain of the human ZO-1 MAGUK protein
2H2C 2.0 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTWV)
4OEP 2.35 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin1 C-terminal…
3CYY 2.4 Å, The crystal structure of ZO-1 PDZ2 in complex with the Cx43 peptide
3TSZ 2.5 Å, crystal structure of PDZ3-SH3-GUK core module from human ZO-1 in complex with 12mer…
3LH5 2.6 Å, Crystal Structure of the SH3-Guanylate kinase core domain of ZO-1

Browse structure collections

About this viewer

MolViewer shows 3SHW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.