3TSW: PDZ3-SH3-GUK core module of Human ZO-1

crystal structure of the PDZ3-SH3-GUK core module of Human ZO-1. Determined by X-ray diffraction at 2.85 Å resolution. Released 12 Oct 2011.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 8,637
Mol. weight: 179.32 kDa
Released: 12 Oct 2011

Explore 3TSW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TSW contains 36 α-helices and 85 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	421-422	2
β-strand	423-424	2	1
β-strand	427-428	2	2
β-strand	435-440	6	1
β-strand	444-450	7	1
β-strand	466-470	5	1
β-strand	473-474	2	1
α-helix	481-484	4
α-helix	486-489	4
α-helix	491	1
β-strand	495-496	2	2
β-strand	499-501	3	1
α-helix	504-512	9
β-strand	519-523	5	3
β-strand	527	1	4
β-strand	534	1	3
β-strand	537	1	4
β-strand	542-547	6	3
β-strand	556-562	7	3
α-helix	564-566	3
β-strand	568-575	8	3
α-helix	577-585	9
β-strand	633-639	7	3
β-strand	640-641	2	5
β-strand	647-650	4	6
α-helix	654-664	11
β-strand	669-671	3	6
α-helix	692-698	7
β-strand	703-706	4	6
α-helix	710-718	9
β-strand	724-728	5	6
α-helix	733-743	11
α-helix	751-763	13
β-strand	771-773	3	6
α-helix	782-793	12
β-strand	798-801	4	3

Chain B: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	422-428	7	7
β-strand	435-440	6	7
β-strand	444-450	7	7
β-strand	466-470	5	7
β-strand	473-474	2	7
α-helix	480-489	10
β-strand	495-501	7	7
α-helix	504-512	9
β-strand	519-523	5	8
β-strand	527	1	9
β-strand	534	1	8
β-strand	537	1	9
β-strand	542-547	6	8
β-strand	551	1	10
β-strand	553	1	10
β-strand	556-562	7	8
β-strand	568-575	8	8
α-helix	577-583	7
α-helix	584-586	3
β-strand	587-588	2	5
β-strand	633-635	3	8
β-strand	636-639	4	11
β-strand	798-801	4	11

Chain C: 13 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	421-422	2
β-strand	423-428	6	12
β-strand	436-440	5	12
β-strand	444-449	6	12
α-helix	455-458	4
β-strand	466-470	5	12
β-strand	474	1	12
α-helix	480-489	10
β-strand	495-501	7	12
α-helix	505-512	8
β-strand	519-522	4	13
β-strand	523	1	14
β-strand	527	1	15
β-strand	534	1	13
β-strand	537	1	15
β-strand	542-547	6	13
β-strand	557-562	6	13
α-helix	564-566	3
β-strand	568-574	7	13
α-helix	577-584	8
β-strand	633	1	14
β-strand	636-641	6	13
β-strand	647-650	4	16
α-helix	654-664	11
β-strand	669-671	3	17
α-helix	672-673	2
β-strand	703-705	3	17
α-helix	710-716	7
α-helix	717-721	5
β-strand	724-729	6	16
α-helix	733-743	11
α-helix	751-761	11
β-strand	771-774	4	16
α-helix	782-795	14
β-strand	797-801	5	13

Chain D: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	423-425	3	18
β-strand	428	1	19
β-strand	430	1	20
β-strand	432	1	20
β-strand	436-438	3	18
β-strand	446-449	4	18
α-helix	465	1
β-strand	466-470	5	18
β-strand	473-474	2	18
α-helix	480-489	10
β-strand	495	1	19
β-strand	498-501	4	18
α-helix	504-512	9
β-strand	519-523	5	21
β-strand	527	1	22
β-strand	534	1	21
β-strand	537	1	22
β-strand	542-545	4	21
α-helix	550-552	3
β-strand	556-562	7	21
α-helix	564-566	3
β-strand	568-575	8	21
α-helix	577-585	9
β-strand	587-588	2	13
β-strand	633-635	3	21
β-strand	637-639	3	23
β-strand	798-800	3	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tight junction protein ZO-1	A, B, C, D	protein	391	Homo sapiens	Q07157 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3TSW_1 Tight junction protein ZO-1 (chains A, B, C, D)
GSHMILRPSMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNN
VDFTNIIREEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESP
YGLSFNKGEVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPK
TAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGP
IADVAREKLAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNA
VDRLNYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTT
INLNSMNDGWYGALKEAIQQQQNQLVWVSEG

Primary citation

The Src Homology 3 Domain Is Required for Junctional Adhesion Molecule Binding to the Third PDZ Domain of the Scaffolding Protein ZO-1. Nomme, J., Fanning, A.S., Caffrey, M. et al. J Biol Chem (2011) 286:43352-43360. DOI 10.1074/jbc.M111.304089 · PubMed

Other PDB entries of the same protein (UniProt Q07157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q2Q 1.45 Å, ZO1 PDZ3 in Complex with a Phage-Derived Peptide
2H2B 1.6 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTYL)
2RCZ 1.7 Å, Structure of the second PDZ domain of ZO-1
9HM2 1.72 Å, A swapped dimeric form of ZO1/TJP1 PDZ2 in complex with the C-terminal peptide from…
4YYX 1.79 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin2 C-terminal…
4OEO 1.9 Å, High resolution crystal structure of the unliganded ZO-1 PDZ1 domain
3TSV 1.99 Å, crystal structure of the third PDZ domain of the human ZO-1 MAGUK protein
2H2C 2.0 Å, Crystal Structure of ZO-1 PDZ1 Bound to a Phage-Derived Ligand (WRRTTWV)
4OEP 2.35 Å, Crystal structure of the ZO-1 PDZ1 domain in complex with the 7-mer Claudin1 C-terminal…
3CYY 2.4 Å, The crystal structure of ZO-1 PDZ2 in complex with the Cx43 peptide
3TSZ 2.5 Å, crystal structure of PDZ3-SH3-GUK core module from human ZO-1 in complex with 12mer…
3LH5 2.6 Å, Crystal Structure of the SH3-Guanylate kinase core domain of ZO-1

Browse structure collections

About this viewer

MolViewer shows 3TSW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.