4P3W: Human filamin A Ig-like domains 20-21

Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Aug 2015.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 12
Atoms: 8,100
Mol. weight: 130.81 kDa
Ligands: PR
Released: 12 Aug 2015

Explore 4P3W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P3W contains 55 α-helices and 112 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2162-2165	4	1
α-helix	2171-2173	3
β-strand	2174-2179	6	2
β-strand	2185-2187	3	2
α-helix	2188	1
β-strand	2189-2192	4	1
β-strand	2197-2201	5	1
β-strand	2209-2216	8	2
β-strand	2219-2220	2	2
α-helix	2221	1
α-helix	2224	1
β-strand	2226-2229	4	2
α-helix	2238-2240	3
β-strand	2242-2244	3	3
α-helix	2246-2248	3
β-strand	2251-2252	2	2
β-strand	2257-2262	6	3
β-strand	2269-2277	9	2
α-helix	2280-2281	2
β-strand	2282-2287	6	3
β-strand	2292-2298	7	3
β-strand	2303-2311	9	2
β-strand	2314-2315	2	2
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	2
α-helix	2327-2328	2

Chain B: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2162-2165	4	3
α-helix	2171-2173	3
β-strand	2174-2179	6	2
β-strand	2185-2187	3	2
α-helix	2188	1
β-strand	2189-2192	4	3
β-strand	2197-2201	5	3
β-strand	2209-2216	8	2
β-strand	2219-2220	2	2
α-helix	2221	1
α-helix	2224	1
β-strand	2226-2229	4	2
α-helix	2238-2240	3
β-strand	2242-2244	3	1
α-helix	2246-2248	3
β-strand	2251-2252	2	2
β-strand	2257-2262	6	1
β-strand	2269-2277	9	2
α-helix	2280-2281	2
β-strand	2282-2287	6	1
β-strand	2292-2298	7	1
β-strand	2303-2311	9	2
β-strand	2314-2315	2	2
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	2
α-helix	2328	1

Chain C: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2162-2165	4	12
α-helix	2171-2173	3
β-strand	2174-2179	6	9
β-strand	2185-2187	3	9
α-helix	2188	1
β-strand	2189-2192	4	12
β-strand	2197-2201	5	12
β-strand	2209-2216	8	9
β-strand	2219-2220	2	9
α-helix	2221	1
β-strand	2223-2229	7	9
α-helix	2238-2240	3
β-strand	2242-2244	3	8
α-helix	2246-2248	3
β-strand	2251-2252	2	9
β-strand	2257-2262	6	8
β-strand	2269-2277	9	9
α-helix	2280	1
β-strand	2281-2287	7	8
β-strand	2292-2299	8	8
β-strand	2303-2311	9	9
β-strand	2314-2315	2	9
α-helix	2319	1
β-strand	2321-2326	6	9

Chain D: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2162-2165	4	8
β-strand	2174-2179	6	9
β-strand	2185-2187	3	9
α-helix	2188	1
β-strand	2189	1	10
β-strand	2197-2200	4	8
β-strand	2201	1	10
β-strand	2209-2216	8	9
β-strand	2219-2220	2	9
α-helix	2221	1
α-helix	2224	1
β-strand	2226-2229	4	9
β-strand	2233	1	11
β-strand	2235	1	11
α-helix	2237-2240	4
β-strand	2242-2244	3	12
α-helix	2246-2248	3
β-strand	2251-2252	2	9
β-strand	2257-2262	6	12
β-strand	2269-2277	9	9
α-helix	2280-2281	2
β-strand	2282-2287	6	12
β-strand	2292-2298	7	12
β-strand	2303-2311	9	9
β-strand	2314-2315	2	9
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	9

Chain E: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2162-2165	4	4
α-helix	2171-2173	3
β-strand	2174-2179	6	5
β-strand	2185-2187	3	5
α-helix	2188	1
β-strand	2189-2192	4	4
β-strand	2197-2201	5	4
β-strand	2209-2216	8	5
β-strand	2219-2220	2	5
α-helix	2221	1
β-strand	2223-2229	7	5
α-helix	2238-2240	3
β-strand	2242-2244	3	6
α-helix	2246-2248	3
β-strand	2251-2252	2	5
β-strand	2257-2262	6	6
β-strand	2269-2277	9	5
α-helix	2280-2281	2
β-strand	2282-2287	6	6
β-strand	2292-2298	7	6
β-strand	2303-2311	9	5
β-strand	2314-2315	2	5
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	5

Chain F: 8 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	2163-2165	3	6
β-strand	2175-2179	5	5
β-strand	2185-2187	3	5
α-helix	2188	1
β-strand	2189	1	7
β-strand	2197-2199	3	6
α-helix	2200	1
β-strand	2201	1	7
β-strand	2208-2215	8	5
β-strand	2220	1	5
α-helix	2221	1
β-strand	2223-2230	8	5
α-helix	2237-2240	4
β-strand	2242-2244	3	4
α-helix	2246-2248	3
β-strand	2251-2252	2	5
β-strand	2257-2262	6	4
β-strand	2269-2277	9	5
α-helix	2280-2281	2
β-strand	2282-2287	6	4
β-strand	2292-2298	7	4
β-strand	2303-2311	9	5
β-strand	2314-2315	2	5
α-helix	2316	1
α-helix	2319	1
β-strand	2321-2326	6	5

Chains G, H, I and K: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	9-17	9	2
α-helix	18-19	2

Chains J and L: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	9-17	9	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin-A	A, B, C, D, E, F	protein	182	Homo sapiens	P21333 (AlphaFold model)
Filamin-binding LIM protein 1	G, H, I, J, K, L	protein	24	Homo sapiens	Q8WUP2 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>4P3W_1 Filamin-A (chains A, B, C, D, E, F)
GAMGSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEM
GTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAG
AGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVAS
PS

Sequence of entity 2 (G, H, I, J, K, L), FASTA

>4P3W_2 Filamin-binding LIM protein 1 (chains G, H, I, J, K, L)
PEKRVASSVFITLAPPRRDVAVAE

Ligands and cofactors

ID	Name	Formula	Copies
PR	Praseodymium ion	Pr	4

Water and common crystallization additives (NA, SO4) are not listed.

Primary citation

Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin peptide. Seppala, J., Pentikainen, U., Ylanne, J. To be published.

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex
3RGH 2.44 Å, Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

Browse structure collections

About this viewer

MolViewer shows 4P3W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.